KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0334Help
Entry
y0334             CDS       T00092                                 

Definition
(GenBank) putative 2-component regulator
  KO
K07391  magnesium chelatase family protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase ChlI Mg_chelatase_C MCM AAA_5 Sigma54_activat AAA_32 AAA_16 AAA RuvB_N AAA_22 Sigma54_activ_2 IstB_IS21 AAA_30 ABC_tran AAA_33 AAA_11 AAA_19 AAA_25 TIP49 AAA_24 PIF1
Motif
Other DBs
NCBI-ProteinID: AAM83925
UniProt: Q8D1L5
Position
complement(368467..370011)
Genome map
AA seq 514 aa AA seqDB search
MTAKESIMSLATIHTRATLGIQAPPVAVEVHISNGLPGLILVGLPETTVKEARDRVRSAL
INSGFNFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLAHYEFLGELALS
GALRRVSGAIPAALTCSEANRQLILPTANGLEIGLIPQGNSWVADHLLAVCGFLQGENPL
AQGQPFEPAPSPDNHLDLHDIIGQSQAKRALEIAAAGGHNLLLLGPPGTGKTMLATRLTG
LLPPLTDQEALEAAAITGLLHSNALPTQWRCRAFRAPHHSASMAALIGGGSIPRPGEISL
AHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKICFPAKVQLIAAMNPSPSGHY
QGVHNRTPPQQILRYLAKLSGPFLDRFDLSIEVPLLPAGMLGAQKNQGESSATVKQRVLQ
ARQRQMDRAGKINTQLTSQEVAEFCYLAPEDAAFLEQVLLTLGLSVRAWHHILKVARTIA
DLAQEKTIQKSHLSEALSYRCMDRLLLQLHKSLM
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaaggaaagcataatgtcactggcaaccattcatactcgcgcaacattgggc
attcaagcccctcctgtcgcggtagaagttcatatcagcaatggattacccggattgata
ttggtcggcttacctgaaacaacggtcaaagaagcacgggatcgggttcgtagcgcatta
attaacagcggttttaattttcccgccaagcggatcaccgtcagcctggcaccggcagat
ttacccaaagaaggcgggcgctatgatctccccattgctttagccatcttggccgcctca
gagcagatccctgcggataagttagcgcactatgagttcttgggtgaattagccctatcc
ggcgcgttaaggcgcgttagcggcgcaattccagcagcactcacctgtagcgaagctaac
cgtcagttaatccttcccaccgctaatggtcttgaaattggtctaatcccacaaggcaac
tcctgggtcgcagaccatttattagcggtatgcggtttcttacaaggtgaaaaccccctc
gcacagggccagcccttcgaaccggccccttcaccggataaccaccttgatttacacgac
atcattggtcaatcgcaggctaaacgtgcgttagaaatcgcggcggcaggtggtcataac
ctgctgttactcgggccaccaggtaccggtaaaacgatgctggcaacccgcctaaccggg
ttattgcctccgctgaccgatcaggaggcgttagaagcagcggcgatcaccgggttgctg
catagcaacgcactgccaacacaatggcgttgccgggcctttcgtgccccacaccatagc
gcatcgatggcagcgctgattggcggcggctccatcccccgccccggtgagatatcactg
gcccataacggtgtgttatttctcgatgaactgcctgaatttgaacgccgggtactggat
tcactgcgcgaaccgttggaatctggcgaaattattatctcccgcgcggcagccaaaatc
tgttttccagccaaagtgcaacttatcgcggcgatgaaccctagccccagcggccactac
caaggcgttcataaccgcacaccgccacagcaaattttgcgctatctggccaagttgtcc
gggccatttctcgatagattcgatttatcgatagaagtgccattactgccagccggtatg
ctgggtgcgcagaaaaatcagggggagagtagcgctacagtcaagcagcgagtgttacag
gccagacaaaggcaaatggaccgggcggggaagatcaatacgcagctcactagccaagag
gtagcagagttttgttatttagcacctgaggatgccgcgtttctcgagcaggttttactg
acactcggcctgtcagtacgtgcctggcaccatattttgaaagtggcgcgaaccattgcc
gatttagcgcaagaaaagaccatccaaaaaagtcatctttcagaggcgctgagctatcgc
tgtatggatcgcctgctattgcagttgcacaaaagcctgatgtaa

DBGET integrated database retrieval system