KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0345Help
Entry
y0345             CDS       T00092                                 

Gene name
ilvC
Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00290  Valine, leucine and isoleucine biosynthesis
ypk00770  Pantothenate and CoA biosynthesis
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01130  Biosynthesis of antibiotics
ypk01210  2-Oxocarboxylic acid metabolism
ypk01230  Biosynthesis of amino acids
Module
ypk_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ypk_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    y0345 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    y0345 (ilvC)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     y0345 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_7 ApbA AdoHcyase_NAD Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AAM83935
UniProt: Q8ZAC2
Position
381832..383310
Genome map
AA seq 492 aa AA seqDB search
MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDSG
LDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDKQHSAVVKAVQP
LMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEGKISEQEYFDHGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFANAAVPLLKEKFMDSLQAGDLGKSIPGSAVDNAQLRDVNEAIRNHPIEAVGHKLRG
YMTDMKRIAVAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctaactatttcaacacattgaacctgcgtcagcagttggcgcaattaggtaagtgt
cgctttatggcacgtgacgaatttgccgatgaagccggctacctgaaaggcaaaaaagtg
gtgattgtcggttgtggcgcacagggcctgaaccaagggttgaacatgcgtgactccggc
ctggatgtcgcttatgccctgcgtaaagaagcgattgccgagaagcgtgcttcatggcgt
aaagcgaccgaaaatggtttcaaagtaggcacttacgaagagttgatcccacaggcggat
ctggtggttaacctgacgccagacaagcagcactctgccgtggttaaggcggttcagcct
ctgatgaaagagggcgcagcactgggttactcgcatggtttcaacattgttgaagtgggt
gagcaagtgcgtaaagacatcaccgtggtgatggttgcgccgaaatgccctggtaccgaa
gttcgtgaagagtacaaacgtggttttggtgtgccgacgctgattgcggttcatccagaa
aacgaccctaaaggcgaaggcatggcgattgctaaagcctgggccgcggccaccggtggt
caccgtgcgggtgtactggaattttcttttgttgccgaagtgaaatctgacctgatgggc
gagcaaactatcctgtgtggtatgttgcaggcgggttcactgttatgtttcgacaagttg
gtttcagagggtactgatgccgcttacgctgaaaaactgattcaattcggctgggaaacc
attaccgaagcgctgaaacaaggcgggatcacgctgatgatggaccgtttgtctaatcca
gcaaaactgcgtgcgtatgcattatctgaacagttgaaagaaattatggcgccattgttc
cagaaacacatggacgacattatttctggtgcgttctccagcggcatgatggctgactgg
gctaacgatgacgttaagttgttgaactggcgtgaagagaccggcagaacggcttttgaa
aatgcgccacagtttgaaggcaagatctctgagcaggaatattttgaccacggcgtactg
atgatcgcgatggtaaaagcgggagttgagctggcattcgaaaccatggtggattccggc
attattgaagagtctgcttactacgaatctctgcacgagctgccgttgattgccaacact
atcgcccgtaagcgtctgtatgaaatgaacgtggttatctctgataccgcagaatacggt
aactacttgtttgctaatgcagcggtgccgttgctgaaagagaagtttatggattccctg
caagccggtgacttgggtaaaagtatccctggttcggcggtagataacgcacaactgcgt
gatgtgaatgaagccattcgcaatcacccgatcgaagccgttggtcataagctgcgtggt
tacatgacagatatgaagcgtattgctgttgcgggctaa

DBGET integrated database retrieval system