KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0352Help
Entry
y0352             CDS       T00092                                 

Definition
(GenBank) fimbrial protein (precursor)
  KO
K07345  major type 1 subunit fimbrin (pilin)
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y0352
   02035 Bacterial motility proteins [BR:ypk02035]
    y0352
Secretion system [BR:ypk02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   y0352
Bacterial motility proteins [BR:ypk02035]
 Pilus system
  Fimbrial proteins
   y0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FimA DUF2574
Motif
Other DBs
NCBI-ProteinID: AAM83942
UniProt: Q0WAD5
Position
complement(392608..393138)
Genome map
AA seq 176 aa AA seqDB search
MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGLEANPVVLLPTVSSSDL
DASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGNLQNTGTAGNVELQLLKDA
TTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQSTPGSVIASVQYAVSYL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattactttagctatcgcgttattctcggcatctacaacggttgccatgtct
gccagtaataatacgattacgttccaaggggaagtcacagcacaaacctgttctgttacc
gtaaacggccttgaagcaaatccagttgtcttgttgcctacagtatcaagtagcgattta
gacgcttccggccaaactaaaggcaaaacaacctttacgctaggtgtgtctggctgtaca
tcaggatcagatgatcttgatatcaaaactgttttcatcggtagcctggttactgctact
ggtaatttacaaaatacaggtaccgcagggaacgttgaacttcaattattgaaggatgcc
acgacaacaacgggtatcgacctgaatagtggtttggcacaagacggtatcgtgttgcta
gcaggtgatacatctgcggagcatgattttgctgttcagtattatgccactgggcaatca
acaccagggtctgtcattgcatctgtacagtatgccgtttcttacttgtaa

DBGET integrated database retrieval system