KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0354Help
Entry
y0354             CDS       T00092                                 

Definition
(GenBank) glutamine cyclotransferase
  KO
K22757  glutaminyl-peptide cyclotransferase [EC:2.3.2.5]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    y0354
Enzymes [BR:ypk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.5  glutaminyl-peptide cyclotransferase
     y0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_cyclase_2 SBBP
Motif
Other DBs
NCBI-ProteinID: AAM83944
UniProt: A0A0H2W770
Position
complement(395253..396044)
Genome map
AA seq 263 aa AA seqDB search
MEILNIPRRCFTFLLIIITYSFPLSFADSKPLKYTFEVIRKIPHDETSFTQGLVIDDGKL
YETTGLYKNSKIRELDLTNGKVIRSVNLPDNIFGEGITKLGDSFYVLTWKEKKAFVINPN
DLKIIKTFNYEGEGWGLTTDGINLIMGDGSDTLYFRNPADFSIIKKISVTFDGRRIEKIN
ELEWIDGMIYANVWYSDAILVIEPENGRVVKWIELSGLQFMLDSVNRNTNTLNGIAYDKS
KNKIYLTGKNWSNIFEVKFLTSK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggagatattaaatatacctcgccgttgctttacttttttattaattataatcacatat
agctttcctttatctttcgcagattctaaacctctgaagtatacctttgaagtgataaga
aaaattccgcatgatgaaacatcttttacgcaagggcttgtcattgatgacggtaaatta
tatgaaacgaccggcctctataaaaactctaaaatcagggagttagacttaaccaatggt
aaggtcattaggtcagtgaatttaccagataatatttttggtgaagggatcactaaatta
ggtgatagtttctacgtattaacctggaaagaaaaaaaagcatttgtcattaaccctaat
gatttgaaaattataaaaacattcaattatgaaggagaaggatgggggttaacgaccgat
ggtatcaatctcattatgggggatgggagcgatactctttattttcgtaacccagcagat
ttctcaattataaaaaaaatatcagtgacctttgatggccgaagaattgaaaaaattaat
gagctagaatggattgatggaatgatttatgccaacgtatggtatagcgatgctatatta
gtgattgaacctgaaaatggtagagtggttaagtggattgagttgtcagggctacaattc
atgctcgattcagtcaaccgtaacactaatacactcaatggtattgcttacgataaaagc
aaaaataaaatatacctcactggaaaaaactggtccaacatctttgaagtgaaattttta
acatccaaatga

DBGET integrated database retrieval system