KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0363Help
Entry
y0363             CDS       T00092                                 

Gene name
wzzE
Definition
(GenBank) putative transport protein
  KO
K05790  lipopolysaccharide biosynthesis protein WzzE
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    y0363 (wzzE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR
Motif
Other DBs
NCBI-ProteinID: AAM83952
UniProt: Q8D1K6
Position
405576..406655
Genome map
AA seq 359 aa AA seqDB search
MMKPESMSTDKTGSTNNEPSVDNELDIRGLCRTLWRGKVWIIGMAIIFAAIALGVSYLVK
QQWSATAITDKPTVNNLGGYYSQQQFLRNLDIRLNSGLVSEQPGISDEAYGEFITQLAAY
DTRRDFWLQSDYYKQRLEGDAKADAALLDELVNNIVFTARDDKKIPNDSIKLTAETASDA
NKLLRGYIDFASQRASSHLNDEIQGAWAARTQSMKAQVKRQEAVAQAVFDREVAAVKQAL
KVAGQQGITSSQTDTPAEQLADSKMFMLGKPMLEARLETLLATGPSFDIDYDQNRAMLAT
LNVGPTLDDKFQTYRYLRTPEDPVTRDSPRRVFLLIMWGAIGALVGAGVVLVRRSSKAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaccagaatctatgtcgactgataaaacagggtctaccaataatgaaccgtct
gtggataacgaattagatatccgtggtctgtgtcgtactctatggcgtggcaaggtatgg
attatcggtatggccattattttcgctgcgattgcactgggagtctcctatctggtgaaa
cagcagtggagtgcgacagccattactgacaaaccaaccgtcaacaatttgggggggtat
tattcgcaacagcagtttttacgtaatcttgatatccgtctcaatagcgggcttgtcagt
gaacagccaggcatctccgatgaagcttacggtgagttcattactcagttagcggcttac
gatacccgtcgtgatttctggctacaaagcgattactacaagcaacggcttgagggagac
gctaaggcggatgcggcattactcgatgagctagtgaataacattgttttcacggcgcgt
gatgataaaaaaatcccgaatgacagcattaaattgacggcagaaacggccagtgatgcg
aataagctactgcgtggttacattgattttgccagtcaacgtgcgtcaagccacctgaat
gatgaaattcaaggcgcttgggcagcgcggactcaatcaatgaaagcgcaggttaaacgc
caggaagcggtagctcaagcagtctttgatcgtgaagtggcggcggttaagcaagcattg
aaagtggctgggcaacaaggtattaccagtagccagacagatacgccagccgagcaattg
gcagattccaagatgttcatgctaggtaagccgatgcttgaagcccgtttagaaacatta
ctggctactggcccaagttttgatattgattatgatcaaaaccgtgccatgctggcaaca
ttgaacgttggtccgacactagatgataaattccagacttaccgctacttacgtacacca
gaagacccggttacccgtgatagcccacgtcgtgtgttcctgctgattatgtggggcgct
atcggggcattagtcggtgcgggtgtggtattggttcgccgctccagtaaggcactgtga

DBGET integrated database retrieval system