KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0366Help
Entry
y0366             CDS       T00092                                 

Gene name
rffG
Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00521  Streptomycin biosynthesis
ypk00523  Polyketide sugar unit biosynthesis
ypk00525  Acarbose and validamycin biosynthesis
ypk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    y0366 (rffG)
   01055 Biosynthesis of vancomycin group antibiotics
    y0366 (rffG)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    y0366 (rffG)
   00525 Acarbose and validamycin biosynthesis
    y0366 (rffG)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     y0366 (rffG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 adh_short Sacchrp_dh_NADP KR
Motif
Other DBs
NCBI-ProteinID: AAM83955
UniProt: Q8D1K5
Position
409316..410389
Genome map
AA seq 357 aa AA seqDB search
MALRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLSVVAGSERYAFEQV
DICDSSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQ
LSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTY
GLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQ
VVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPAKPAGIAHYRDLITYVKDRPGHD
MRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNNESWWRRVQDGSYAGERLGLSD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaggcgaattctcgtcacaggcggggccggttttatcggctctgcggtggtc
aggcatattattgatggcacctcagatagcgtggtggtagtcgataaactcacctatgcc
ggtaatctggagtcgctgtcagtggttgcgggcagtgagcgttatgctttcgaacaagtc
gatatctgtgacagcagtgagttggatcgggttttcgcacagtatcagccgaatgtggtg
atgcatttggctgccgagagccacgttgaccgctcaattgatggccccgccgcgtttatc
gagacgaacgtggttggcacttacaccctgttggaagctgcccgtcactattggcaacaa
ctgagtgttgaagccaagcaggcgttccgctttcaccatatctcaacggatgaggtgtat
ggcgatttacacggcactgacgatttgtttaccgaaaccacgccgtatgcgccaagcagc
ccatattcggcgtctaaagcgtccagtgaccatttagtccgggcttggttgcgtacttat
ggtttaccgactttggtgactaattgttcaaataattacggcccgtatcacttcccagaa
aagctgatcccgctggttattttaaatgcgttggcgggtaagccgctgcctgtttatggc
aatggtgctcaggtccgcgactggttgtatgtagaagaccacgccagagcgttgtatcag
gtggttactgagggtgtggtgggtgaaacctacaatatcggcggccataatgagcgcaag
aatattgaagtagttgaaaccatttgcgcgctattggatgagttggtgccagcaaaaccg
gcgggtatcgcacactaccgtgatttgattacctacgtaaaagaccggccgggtcatgat
atgcgctatgccattgatgctggcaagattgagcgggaactgggttggcgtccacaagaa
accttcgaaagcggtatccgtaaaacggtcttgtggtatttgaataatgaatcttggtgg
cgtcgtgttcaggatggctcttacgccggagagcgtttgggcttgagtgactaa

DBGET integrated database retrieval system