KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0384Help
Entry
y0384             CDS       T00092                                 

Definition
(GenBank) hypothetical
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPAM_2 DUF4245
Motif
Other DBs
NCBI-ProteinID: AAM83973
UniProt: Q0WAG4
Position
429787..429975
Genome map
AA seq 62 aa AA seqDB search
MKKELRWPMAAMMVLALAGCGLKGPLYFPPADKAPVDAAPQVEKNQQDLSATPQTPSTAE
SQ
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaactacgttggccgatggctgcaatgatggtacttgcacttgctggttgt
ggcctgaaaggcccgttatactttccaccggcggataaagccccggtcgatgcagcgcca
caggtagagaaaaatcagcaggatctgtctgctacaccacagaccccctctactgccgag
tcacagtga

DBGET integrated database retrieval system