KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0393Help
Entry
y0393             CDS       T00092                                 

Gene name
corA
Definition
(GenBank) magnesium and cobalt permease
  KO
K03284  magnesium transporter
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y0393 (corA)
Transporters [BR:ypk02000]
 Other Transporters
  Pores ion channels [TC:1]
   y0393 (corA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorA CheY-binding
Motif
Other DBs
NCBI-ProteinID: AAM83982
UniProt: Q8ZAG5
Position
439542..440540
Genome map
AA seq 332 aa AA seqDB search
MLQCVSLSITAREFWHMLSAFKLHNNRLSRLELDESDDLASSLWVDLVEPEEGERERVQT
ELGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDADDHAGNSTVAFTIRDGRLYTL
RERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSRVIME
GQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKARLPSSQLEQAREVLRDIE
SLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMP
ELRWSFGYPGAIALMIIAGLAPYLYFKRKNWL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcaatgcgtatccctatccatcaccgcaagggagttttggcacatgctgagcgca
tttaaattacacaacaatcgcttatctcgcttggagctggatgaatcagatgatctggcc
tcctcactgtgggtcgatctcgttgaaccggaagaaggtgagcgggagcgcgtccagacg
gagttaggccaaagcctggcgacacggccagagttggacgatatcgaggcttcggcccgt
ttttttgaagatgaagatggtctgcacattcactccttcttctattacgaagatgctgat
gatcatgcgggtaactcgaccgtggcatttactattcgtgatggtcgcctttacaccctg
cgtgagcgtgaattgccggcgtttcgtttgtaccgtatgcgcgcacgtaaccaaacgtta
gttgatggcaacgcttatgagctactgctggatctgtttgaaactaaaattgaacagttg
gcagatgaaattgagaatatttacagcgatttagaagccttaagccgcgtcattatggaa
ggccagcagggtgatgaatacgatgccgccttgtccacgttggcagagcaagaggatatc
ggctggaaagtgcgtttgtgtctgatggatacccaacgggcgctgaatttcttggtacgc
aaagcccgcctgcccagcagccagttagagcaggcccgcgaggttctgcgcgatatcgaa
tccttgctgccacacaatgagtccctgttccagaaggttaacttcctgatgcaggcggcg
atgggttttatcaatatcgaacagaaccgcatcatcaagatcttctcggtggtttctgtg
gtcttcctgccgccaacgctggtggcatcgagctatgggatgaactttgagtttatgcca
gagctacgttggtcatttggttatccgggggccattgctctgatgatcattgccggtctg
gctccttatctgtacttcaaacgtaaaaactggctctag

DBGET integrated database retrieval system