KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0510Help
Entry
y0510             CDS       T00092                                 

Gene name
acs
Definition
(GenBank) acetyl CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00010  Glycolysis / Gluconeogenesis
ypk00620  Pyruvate metabolism
ypk00640  Propanoate metabolism
ypk00680  Methane metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01130  Biosynthesis of antibiotics
ypk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y0510 (acs)
   00620 Pyruvate metabolism
    y0510 (acs)
   00640 Propanoate metabolism
    y0510 (acs)
  Energy metabolism
   00680 Methane metabolism
    y0510 (acs)
Enzymes [BR:ypk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     y0510 (acs)
Lipid biosynthesis proteins [BR:ypk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   y0510 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAM84099
UniProt: Q8D1G8
Position
complement(577565..579529)
Genome map
AA seq 654 aa AA seqDB search
MTMSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNT
SFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVC
QFANVLKSLSVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS
HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH
DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPG
DIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAP
TAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTET
GGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLF
GDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVA
HPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHW
TDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagccaaatacataaacatcctattccagctgcaattgcagagcatgctcta
attaccccagaaaaataccaacattattaccaacaatccgtgcagaaccctgatgaattc
tggggcgaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacc
tcctttgaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcg
gcgaattgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaa
ggtgatgaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgc
cagtttgctaatgtcctaaaaagtttaagcgtcaaaaaaggcgatgtggttgccatctat
atgccaatggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcatcggcgctgtt
cattccgttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattct
cactctaaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactg
aaaaaaaatgtcgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtg
gtcttccaacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcat
gacctgataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccg
ctgttcatcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacg
ggcggttatctggtttatgctgcactgacattcaaatatgtctttgattatcaccctggc
gatatctactggtgtactgcagacgttggctgggtaaccggacacagctatctgttatat
ggaccactggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggc
gtcaatcgcttaagccaagttgttgataaacataaagtcaatattctatacaccgcgcct
acagcgattcgggccttaatggccgaaggtgacaaagccatcgaaggaaccaaacgcgac
tcactgcgtattatgggatcggtcggcgagccgattaatccagaagcctgggaatggtat
tacaacaagatcggtaacagtaaatgcccgattgtcgatacttggtggcagactgaaacc
ggtggtttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaacg
cgtccattctttggggtacaacctgcgttggtagataacctgggcaatcctcaggaaggg
gtggcagaaggtaatctggtcataaccgactcatggccggggcaagccagaacattattt
ggcgatcatgaacgtttcgaacaaacctacttctcaacctttaaaggcatgtatttcagt
ggcgacggcgcacgtcgtgacgaagacggttactactggataaccggtcgagttgatgac
gtactaaacgtttcaggccatcgcttaggaacggctgaaattgaatctgcattggttgca
cacccgaaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggct
atttatgcctatatcacgctaaatcacggtgaagaaccaacgccagagttatataccgaa
gtacgcaactgggtacgtaaagagattggcccactcgcaacacccgatattttgcattgg
acggactcattacccaaaacccgttcaggcaagatcatgcgccgtattttacgcaaaatt
gcgacaggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggta
gaaaaattactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system