KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1208Help
Entry
y1208             CDS       T00092                                 

Gene name
fur
Definition
(GenBank) negative regulator
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypk03000]
    y1208 (fur)
Transcription factors [BR:ypk03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    y1208 (fur)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR SR1P PadR HTH_12
Motif
Other DBs
NCBI-ProteinID: AAM84784
UniProt: P33086
Position
complement(1359874..1360320)
Genome map
AA seq 148 aa AA seqDB search
MTDNNKALKNAGLKVTLPRLKILEVLQNPACHHVSAEDLYKILIDIGEEIGLATVYRVLN
QFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSNESIESLQREIAKQHGI
KLTNHSLYLYGHCETGNCREDESAHSKR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacaacaaagccttaaaaaacgctggccttaaagtcacactcccccggctt
aaaattctggaagtgttgcaaaatcctgcgtgtcaccacgtcagcgcggaagatctttat
aaaatactgatcgatattggtgaagagattggcttagcaacggtttaccgtgttctgaac
caatttgatgatgctggtattgttacccgccacaatttcgaagggggtaaatcagttttt
gagctgactcaacaacatcaccacgatcacctaatttgcctggattgcggcaaagtgatc
gagtttagcaacgaatccattgaatcacttcaacgtgaaattgctaaacaacatggcatc
aagctgactaatcatagcctgtatttatacggtcactgtgaaaccggcaattgccgtgaa
gatgagtctgcacacagtaaaagataa

DBGET integrated database retrieval system