KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1530
Entry
y1530             CDS       T00092                                 

Definition
(GenBank) hypothetical
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB
Motif
Pfam: OmpA rve
Other DBs
NCBI-ProteinID: AAM85101
UniProt: Q0WCV9
Position
complement(1693125..1694807)
AA seq 560 aa
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHP
QVSTPIPQETAEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQK
RLTYIAEHHPSARVLTFFPFLPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQ
LSNERLSHNSDNAYWTGNINLANQQPIEITQALQSLSQRLELQDINHSRFATQRNVMAHN
LFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRHGAWSAWLEKKFGIIPSLAST
LSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHMLNTLWQEKNR
HEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHS
DNTGSSSMNMALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRR
VEVLILPTQDRTRMTEPKPL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtttaaggttaaattgaataaaacgctctctctattatggctggctgcggtcggcgcc
ctattggtgagtgtgaattttaagggaaatgcgttatggaataacgttattttcattact
ttcctggcgctgatggttcttgccatctggaaacattacgccctcaaacccaaacacccc
caagtgtcgactcccattccgcaggagacagcggaacctgtagaacaggagagtacggtt
attttaattctcggtccctatgctgagaaatggtttagtaacccagaatcgccagacagt
acacgtttttccagccatgcggtttggatattaatcacgaatcccgccgcgctgcaaaaa
cgcctcacatatattgctgaacatcatccatccgctcgggtattgacctttttccctttc
ttgccggatgtctatgagaatgcagcagtgatgatgtcaaaactcactgtgtggcagaac
actttttcaacgttatcactgcgatcccccctcccctgcgtatttgctatttacgcgcag
ttgagtaatgaacgccttagccataattctgataacgcatattggactggaaatattaat
cttgcgaaccagcagcctatcgagattacgcaagccctacagtcactgagccaacgactt
gagttacaagacatcaatcactcaagatttgcaactcagcgtaatgttatggcgcataat
ttatttacttggttgaatgaatcgggggtgacaaaccttctgcaatctattttctctcgc
acccccttacggctaacagatgtcattttgtcggataatggcaaagggttcatcaggcat
ggtgcctggtcagcctggctggaaaaaaagtttggcatcataccaagcttagcctcaacc
ttgtcactgccacctttcccagcggtgatcaatgaccagaagcccgcaatgaaaccacgg
gtgaaaacaccggtgataaaacctacccccgcatcccgcgggtggttatggagtgtatgc
ttcgccgcggtgctattagcctcacatatgctaaacaccctgtggcaagaaaaaaaccgg
catgagcaatttaaccaacagatggtgccgttggacaatatcagcgatttttctgctcag
tacctggcacgcagcatcacccagttaactgatgaaggtaaaatattaaccacatgcgtt
aatacatttgatgtcacacgttgggggctgtctcaatgcaagacgttattaagccaaatc
aaccgccggattgaatcctatgaaaatattcctgttttcagttttgcccaaaagctccct
ctgtttgactcaaacagtaccaagctgaaactgaactcacaaactaatgaaatgatgatg
gagttgttatcactggtcgaacggaataaagagaaaaaaatcttaattgttggccattct
gataacacaggcagttcctccatgaacatggcactttccgaacagcgtgcgctggccctt
cgcgattggttaattaaacgcagtgatatcactgtcgataattttattaccaagggaatg
ggggcttcagaaccggttgcgaccaatcacacggaagcgggtcgagaacaaaacagacgc
gtcgaagtactgatattacccacacaagatagaacaagaatgacggagcctaaaccttta
tga

DBGET integrated database retrieval system