KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1547
Entry
y1547             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y1547
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y1547
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y1547
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AAM85117
UniProt: Q8CLE0
Structure
PDB: 
3V4H

Position
1714341..1714910
AA seq 189 aa
MCLRIHMGSSYTRCFALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNW
DVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGD
PLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISAN
YDVKANMHS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtgcctccgtattcatatggggtcttcctacactcgatgttttgcattgagtgacatt
tataaaagtgctagagaggatattatggcgcaagatatgtttatcaaaattgatggtatt
gaaggtgagtctttggatgccaatcacaaaaacgaaatccaggtattagcttggaactgg
gatgttgctcaacactcgaatatgcacagcggttcaggtggcggttcaggtaaagcctct
gtttcagatttttgcttcgcacattatatcgataaagctagcccgaacttattgagctat
tgcttgttgggtaagcacattaaaaatgttcagttcgtactgcgtaaagctggtggcgat
ccgctggaatatctgacaattaaatttaccgatgtcatcattactcgtgttgatatggcg
ggttctttggaagatgaaacgcgtccacgtgaagaaattcgtttctcattcactaagatg
actcaggactatgttatgcagaatgctgaaggccataagtctggcgttatttctgctaac
tacgatgttaaagctaacatgcacagctaa

DBGET integrated database retrieval system