KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1548
Entry
y1548             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11906  type VI secretion system protein VasD
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y1548
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y1548
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y1548
SSDB
Motif
Pfam: T6SS-SciN DUF4969
Other DBs
NCBI-ProteinID: AAM85118
UniProt: Q8CLD9
Position
1715124..1715723
AA seq 199 aa
MWIRLNVFLIRLSMILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLT
VEIATAADINPNDKGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRI
MLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQ
DPIMKVRVERLSISIKEMD
NT seq 600 nt   +upstreamnt  +downstreamnt
ttgtggataaggcttaacgtttttttaattaggctaagtatgattttaattaggctaagt
atgaataaaagtatccgaggggtttaccgggcgacacagtacttatttttggtactggta
acgttattgacgatagcctgtagttcaaaagtgcaacctgaaaaggctgaaaagcttacc
gtcgaaatcgcgacagcagcggatattaatccgaatgataaaggggtggcgaacccgcta
aggattgcactttatacactcaagagcaccgatgaatttcagtcgagtgatttcttcact
atcactgaagaaaatacgccatcgctaaaagaacaaatggataacgtgtttgaccggatt
atgttgccaagcgagaccaaaaaaatagagctgacacttgatgctggcgttactgctatc
ggcatcgtggctgcttatcgtgaaattgaacaggcggagtggaaagcggttatttatccg
ttgcccaaaaaacgcgtggatccttggtataaaaaaatgtggccagggcaagaccaacaa
gatccgatcatgaaggtacgcgttgagcgtctgtcaatatcaattaaagaaatggattaa

DBGET integrated database retrieval system