KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2595Help
Entry
y2595             CDS       T00092                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthetase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00220  Arginine biosynthesis
ypk00250  Alanine, aspartate and glutamate metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01130  Biosynthesis of antibiotics
ypk01230  Biosynthesis of amino acids
Module
ypk_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    y2595 (argG)
   00220 Arginine biosynthesis
    y2595 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypk04147]
    y2595 (argG)
Enzymes [BR:ypk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     y2595 (argG)
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   y2595 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-ProteinID: AAM86150
UniProt: Q8ZFV7
Position
2858284..2859654
Genome map
AA seq 456 aa AA seqDB search
MMTTILKHLPINQRVGIAFSGGLDTSAALLWMQKKGAIPYAYTANLGQPDEEDYEAIPRK
AMEYGAEKARLIDCRKQLVAEGIAAIQCGAFHNTTAGVTYFNTTPLGRAVTGTMLVAAMK
EDDVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFIDELGGRHEMSEFMIQS
GFDYKMSTEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMGVKFWDENVVVKAEEVTV
RFERGYPVALNGVVFDDSVELMMEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMAL
LHIAYERLLTGIHNEDTIEQYHANGRVLGRLLYQGRWFDPQALMLRDSIQRWVASEITGE
VTLELRRGNDYSILNTVSDNLTYKPERLTMEKGDSVFSPDDRIGQLTMRNLDITDTREKL
FNYVETGLLTSSAATGLPQVDNNNLSSGRGLQDKRQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacaactattcttaaacaccttcctattaatcagcgtgttggtattgctttttcc
ggtggcctggacaccagtgcggcactgctgtggatgcaaaaaaaaggcgccattccttac
gcttataccgctaatctgggtcagcctgatgaagaagattacgaggccatcccgcgtaaa
gcgatggaatacggcgcggaaaaagcccgtctgatcgattgccgtaagcagttggtggca
gaaggtatcgccgctattcaatgtggcgcattccataacaccacggcgggtgtcacttat
ttcaacaccaccccactgggccgtgcggtaaccggcaccatgctggtggcagccatgaaa
gaagatgatgtaaatatctggggtgacggtagcacttataaaggtaacgatatcgagcgc
ttctatcgttacggtctgctgaccaacgctgagctgaaaatttacaaaccgtggctggat
actgatttcatcgatgaattgggcggccgccatgagatgtcagaatttatgatccaatcc
ggtttcgactacaaaatgtcaaccgagaaagcctactcgaccgactccaatatgttgggt
gccacccacgaggccaaggatctggagttcctcaattccagcgttaaaatcgttaacccg
attatgggcgtgaaattctgggacgaaaatgtggtggtgaaggccgaagaagtcactgtc
cgttttgaacgtggttacccggtcgcgctaaatggtgttgtctttgacgatagcgttgag
ctgatgatggaggctaaccgcatcggtggccgtcacggtctgggtatgagtgatcagatt
gaaaaccgtatcatcgaagccaaaagccgtggcatctatgaagcccctgggatggcgctg
ttgcatatcgcctatgagcgcttgctaacaggtattcacaatgaagataccattgagcaa
tatcatgctaatgggcgggtactgggtcgtctgctatatcaaggccgttggtttgatcca
caagcgctgatgctgcgtgactccattcagcgttgggttgccagcgagataaccggtgaa
gtgacgctggagctgcgtcgtggcaatgattactccatcctgaataccgtgtctgacaat
ctgacttacaaaccagaacgtttgaccatggagaaaggtgattccgtgttctcaccagat
gatcgtatcggccaactgacgatgcgtaatctggacatcaccgatacccgcgagaagtta
ttcaactatgttgagacggggctgttaacctcttctgcggcgacggggttaccacaagtg
gataacaataatctgtcgtcagggcgtgggttgcaggataagcgtcagtaa

DBGET integrated database retrieval system