KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2679
Entry
y2679             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11911  type VI secretion system protein VasL
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y2679
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y2679
SSDB
Motif
Pfam: VasL ImpA_N EF-hand_7
Other DBs
NCBI-ProteinID: AAM86232
UniProt: A0A5P8YG58
Position
complement(2957706..2959073)
AA seq 455 aa
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQ
TAVDFTLARTHTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWR
TMTLCYGDLAQVYRAERALEQLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGL
AKPRGASEPPESLRFASVPVSEPLVYIISEPAPPPVQVVLPASPPRWKAGHGFAAGLSLM
AVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIAELKKQASDVEWARLAEPVLQ
ASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRAAGAAPLVELK
HYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcaggtaataccgagcgtctgctgaaaaccggtggcgatccgcgcgcactggcggat
ttcaccgcactgcggggtgaattaaataaactggcccacccggcccgcccggatgttgat
tgggtgcgagtcgagcagctttgtttggcgctgtttcgccagaacggcgttgagttacag
actgccgttgattttaccctggcacgaacgcacaccgttgggttggcgggcttatgtgaa
gggctggaactgttggcggggttggtctgccatcaatggcgtgggttatggccaccgcaa
acgcatgcccgggtggcgttactggcctggttgagcgaccggctgcagcaagtgtggcgc
accatgacgctgtgctacggtgacctggcgcaggtgtaccgggcagagcgggcgctggaa
cagttgtgtacgcagttgcaaacgctggagctcaaacatttgtgcaagctggacggggtt
cgtttgatgctgcataacgcggcgcagcggttggaaagtaccgaggccgtgtctggcctt
gcgaaaccacggggtgcctctgaaccgcccgagtcgctgcgatttgcctctgtcccggtc
agtgaaccactggtgtatattatcagcgaaccggccccgccacctgttcaggtggtttta
cctgcctcacctccgcgctggaaggcgggccacggttttgccgcggggttatcgttgatg
gcggtactgatggccggcagtttcgttatctggcagtcggtatcatcggatcccgtgagg
gaaacattgctggccactgccagtcctttgccgataccgctgagtgctaactcaatagct
gaactgaaaaaacaggcttcagatgttgagtgggcacgtctggcggaaccggtgttgcaa
gccagtgcgatgcagttagatcaactaacacagttaccgccgttatgggcgcaggctcgg
ggggatgccttgctatctcaggcgcaacaactgtggccgaccaatcaagaggtcaaacga
ctgaatgcgttgtggcagcaacagcgagcagccggtgctgcgcccttggtagagttgaaa
cactatgcattggcgcaagaccgtttgcggcaactggcagaacgactgaatagtctggat
gagaaaaaacgcggatatatgacggtctccgaactgaaatctgccgtctttgctatccaa
cagccgctggcacaggccgtgccactggaagaactgctgcggcaatatcaggaacaatta
gaatcagggcaaactccatcctcagcactgcgtcaacagattgacagccggtttagtcaa
ttgctgaaccgctatgcgttgctggtcgtacctcctggcgttcagtaa

DBGET integrated database retrieval system