KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2737
Entry
y2737             CDS       T00092                                 

Definition
(GenBank) putative dehydrogenase
  KO
K09911  uncharacterized protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    y2737
SSDB
Motif
Pfam: MatP MatP_C RHH_4 PPS_PS TMF_TATA_bd
Other DBs
NCBI-ProteinID: AAM86289
UniProt: Q8ZG78
Structure
PDB: 
3VEA 3VEB

Position
complement(3021319..3021813)
AA seq 164 aa
MLGLSYTVTEELTMKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKL
ENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVL
ARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDKEV
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcttggcttaagttacacggtcactgaagagctcacgatgaaatatcaacagctggaa
aatcttgagagtggttggaaatgggcgtatttggtcaaaaaacaccgtgaaggtgaagcc
attacccgccatattgaaaacagtgcagctcaagacgcagtagagcaactgatgaaactg
gaaaatgaaccagtaaaagtgcaagagtggattgacgcgcatatgaatgtcaatctggcg
accagaatgaaacagactattcgtgcccgtcgtaagcgccactttaatgccgagcaccag
catacgcgtaagaagtcgatcgacctggagtttttggtttggcagcgattggcagtatta
gccagacggcgtggtaatacgctttcagatactgtggttcagttgattgaagatgctgag
cggaaagagaaatatgccagccagatgtcttctttgaagcaggacttgaaagatatttta
gataaagaagtttaa

DBGET integrated database retrieval system