KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2968Help
Entry
y2968             CDS       T00092                                 

Definition
(GenBank) putative 2-component sensor protein
  KO
K07676  two-component system, NarL family, sensor histidine kinase RcsD [EC:2.7.13.3]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    y2968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypk01001]
    y2968
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypk02022]
    y2968
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     y2968
Protein kinases [BR:ypk01001]
 Histidine kinases
  NarL family
   y2968
Two-component system [BR:ypk02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   y2968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c
Motif
Other DBs
NCBI-ProteinID: AAM86519
UniProt: Q8D015
Position
3267861..3269813
Genome map
AA seq 650 aa AA seqDB search
MQNNSSTHSAANITRYFWLFIVLLLMTVGLYAYNYTNAYLTEKKHALTNIANGLQQRIDD
YRYHTYQIYDLVNNPIKASEPPPVVQETRLRPDVYYIEKPRRKTDAIIFGNHEPATLTMA
LQISDYLDNLWGPQNDTYSMYYLNGQDNSLLLITTQALKEVTSRFKESYLTAFAESRRAE
MLQQVNTLDERESFSPLRKLRFQNAYYFTLRTTFNRPGHLATVIAFDLPINDLIPPNMAR
SNFLLQPDKVPLNEGATPEDIAATSVSLNGSWVEFSAPLANVTLKIIYRVPVSHLIIDLL
INNFWLILANIVLLALTILAAYFVRHQYGRPSADVTGQLEAQRLLSQEIITNLPQGLLIY
DFSNSTVIASNKIAENLLPHLNLQKIATMAEQHHGVIQGTVNNEVYEIHMFRSQISPETY
LFLLNDQDKEVLVNKKLQQARREYDKNLQARKLMLHNLGIELGQPVHHLSQLVRTLQDTT
DLQQQHDIKTKLVEQSATILELIDNITLLTKLETQDWQTEQQVFSLSTLIDNLLLDLLPS
INRKGLNLFNHFHVSLDQIYLGDEKVLRKILSLLLNYSIVTTAYGKITLNVDHEPGHPEQ
LVIQIMDTGAGISDEEIGNLNYPFLSQALADRYNHGSGLTFFYVTNYVKN
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaattcgtctacccactcagcggctaacattacacgttacttctggctattt
atcgtacttctgctcatgactgttgggctatatgcctataactataccaatgcttatctg
actgaaaagaagcatgctttaacgaatatcgctaacggtttgcaacaacgcattgatgac
tatcgatatcatacttaccaaatatatgatttagtcaataatccgatcaaagcaagtgag
ccccctcctgtggtgcaggaaacccgcctgcgccctgacgtttactatattgaaaagcct
cgcagaaagactgacgctatcatttttggtaaccacgagcctgcaacgctgaccatggca
ttacagatatctgactatcttgataacctgtgggggccgcaaaatgacacttactcgatg
tactatcttaacgggcaggacaatagcttactcctgattacgactcaggcactaaaagag
gtcacatcacgctttaaagagagctaccttactgcctttgctgaatcgcgacgggcggaa
atgctacagcaggtcaatacgttggatgagcgggagagcttctcgcccttacgcaaattg
cgcttccaaaatgcctactatttcacgctaagaaccacctttaaccgtcctggccattta
gccaccgtgatcgcctttgatttaccgatcaatgatttaattccaccgaacatggcacgt
tcgaacttcctgcttcaaccagataaagtgccactcaatgagggggctacccccgaagat
attgcggcaaccagcgtgtcactgaacggctcatgggttgagttctccgcaccactggca
aatgtcacactgaaaattatttatcgtgtaccggttagtcatttgattatcgacttatta
ataaacaacttttggttaatcctagccaatattgtgttattagcgctaaccattctggcc
gcctattttgtccgccaccaatatggtcgtccaagtgctgatgtgaccggacaattagaa
gctcagagattgttgagtcaggagatcattaccaacctaccgcaaggcttattaatttat
gacttcagcaacagcactgtcattgccagcaacaagatagcggaaaatctactgcctcac
ctgaatctacaaaaaattgccactatggcagagcagcaccacggtgtgattcaagggacg
gttaataacgaagtttatgaaatccacatgttccgtagccagatctcaccagagacgtat
ctttttctacttaatgatcaggataaggaagtcttggtgaataagaaattgcagcaagca
aggcgtgagtacgataaaaatctacaagcgcggaaactgatgttgcacaacctggggatt
gaacttggccaaccggtccaccacctgagccaacttgttcgtacattacaggacactacc
gatttgcaacaacagcatgacattaagaccaagctggttgagcaatcagcaactatcctt
gaactgattgataacatcacgttactgactaagctggaaacacaagattggcaaacagaa
caacaggtcttctctttatcaaccttaatcgataacctgctactggatctgctcccctcg
attaatcggaaaggcttaaatctgtttaatcattttcatgtcagccttgaccaaatttat
ctaggtgatgaaaaggtattacgtaaaatactttcgttgttgctgaattattctatcgtt
accacagcttacggaaaaattaccctcaatgtagatcatgaaccaggacatccggaacaa
ttggttattcaaataatggatactggcgcgggtatttctgatgaagagataggtaatctt
aattatcctttccttagccaagcattggccgacagatacaatcatggttcggggctgaca
tttttttatgtaaccaattatgtaaaaaattaa

DBGET integrated database retrieval system