KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3065Help
Entry
y3065             CDS       T00092                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00020  Citrate cycle (TCA cycle)
ypk00640  Propanoate metabolism
ypk00660  C5-Branched dibasic acid metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01130  Biosynthesis of antibiotics
ypk01200  Carbon metabolism
Module
ypk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    y3065 (sucC)
   00640 Propanoate metabolism
    y3065 (sucC)
   00660 C5-Branched dibasic acid metabolism
    y3065 (sucC)
Enzymes [BR:ypk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     y3065 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAM86615
UniProt: Q8ZH00
Position
complement(3372480..3373646)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggcatgccagctcca
actggctacgcctgtaccactccgcgtgaagcagaagaagccgcatctaaaattggtgca
ggcccgtgggtggttaaatgtcaggttcatgcgggcggccgcggtaaagcggggggcgta
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggctaggtaaaaaa
ctggtcacttaccaaacagatgccaacggacagccggtgcatcagatcttggttgaagca
gccacggatattgataaagaactgtatctgggggcggttatcgatcgcagctctcgccgt
gtggtctttatggcatccactgaaggtggtgttgaaattgaaaaagtcgccgaagagaca
cctgaactgatccataaaatcgcattagatccattgaccggaccacagccttaccaaggg
cgtgagctggcatttaaattgggcttgaccggtaaacaagtcggtcagttcaccaagatc
tttatggggctggcaacactgttcctggaacgtgacctggcgatggtagagattaacccg
ttggtggtcactaagcagggcgatctgatttgtctggatggtaagctcggtgccgatggc
aatgccttgttccgtcagccggaactgcgtgaaatgcgcgatccaagccaagaagatgct
cgcgaagcacatgctgcccagtgggaactgaactatgtggcgttagatggcaacatcggt
tgcatggtaaacggtgccggtttggcgatgggaaccatggacatcgtgaaacttcatggt
ggcgaacccgctaacttccttgatgtgggcggtggtgcaacaaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgataaagtgaaagcggtttttgttaatatcttcggc
ggtatcgtgcgttgtgacctcattgctgacggcatcattggtgcagttgaagaagtgggc
gttaacgtacccgttgttgttcgtctcgaaggtaataatgcagagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system