KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3313Help
Entry
y3313             CDS       T00092                                 

Gene name
speA
Definition
(GenBank) biosynthetic arginine decarboxylase
  KO
K01585  arginine decarboxylase [EC:4.1.1.19]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00330  Arginine and proline metabolism
ypk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    y3313 (speA)
Enzymes [BR:ypk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     y3313 (speA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: AAM86863
UniProt: Q8ZHG8
Position
complement(3648406..3650385)
Genome map
AA seq 659 aa AA seqDB search
MSDDNLISRPLTAGAHVSLRSMQEVAMNDRNASKMLSTYNVAYWGGNYYDVNELGHISVC
PDPDIREARVDLAQLVKKMQLEQGQRLPALFCFPQILQHRLRSINAAFKRARESFGYEGG
YFLVYPIKVNQHRRVIESLVNSGEPLGLEAGSKAEMMAVLAHAGMTRSVIVCNGYKDREY
IRLALIGEKLGHKVYLVIEKMSEIKMVLEEAERLNVVPRLGVRARLASQGSGKWQASGGE
KSKFGLSATQVLQLVDMLREANSLESLQLLHFHLGSQLSNIRDISTGVRESARFYVELHK
LGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNVIWGIGDACNEHGLPHPTVIT
ESGRAVTAHHTVLVSNVIGVERNEFCEPQPPEAGAPRALESLWDTWQEMQEPENRRSLRE
WLHDSQMDLHDVHTQYAHGMLDLTHRAWAEQLYLSICNEIQKQLDPSNRAHRPIIDELQE
RMADKLYVNFSLFQSMPDAWGIDQLFPVLPLEGLDKPPERRAVLLDITCDSDGTIDHYID
GDGVATTMPMPPYDPENPPLLGFFMVGAYQEILGNMHNLFGDTAAVDVYVFPDGTVEVEQ
TDEGDTVADMLEYVQLNPEKLLEHFRGQVKETDLDTELQAQFLEEFEAGLYGYTYLEDE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgataacttgattagccgtccgttaactgcgggcgcacatgtttctttacgc
tccatgcaggaggtagccatgaatgatcgaaatgccagcaagatgctgagcacgtataac
gtcgcctactggggtggcaactattatgacgtcaatgaattaggtcatatcagtgtttgc
cctgatccggatattcgtgaggcgcgtgtcgatctggcgcaactggttaaaaagatgcag
ctcgaacaagggcaacgtttgcctgcgctgttctgcttcccacaaattttacagcatcgt
ctgcgttcaattaacgcggcgtttaaacgtgcgcgtgagtctttcggctatgaaggcggc
tacttcctggtttaccccattaaagtaaaccaacaccgtcgagtgattgagtctttggtc
aattccggcgaaccgttagggctggaagcgggttctaaagctgagatgatggcggtgctg
gcccatgctggcatgactcgttcggttatcgtgtgtaacggttataaagaccgtgaatac
attcgtttggctttgatcggtgaaaaactgggccataaggtgtatctggtcatcgaaaag
atgtcagaaatcaaaatggtcctggaagaagccgagcggctgaatgtggttccacgtttg
ggggttcgcgcccgcctggcatcacaaggttccggtaaatggcaggccagtgggggtgag
aagtccaaatttggtttgtctgcaacgcaggtattacaactggttgatatgctgcgtgag
gcgaatagcctggaaagtttgcaattactgcatttccacttaggttctcaactctccaac
atccgtgatatctccaccggcgtgcgtgaatctgctcgtttctatgtggagttacacaag
ctgggcgttaatatccagtgcttcgatgtgggcgggggcttgggcgtcgattatgaaggg
acgcgctctcaatctgattgctccgttaactatggcttgaatgaatatgccaataacgtt
atctggggtatcggtgatgcctgtaacgaacatggtttgccgcatcctaccgttattaca
gaatctggtcgtgcggttaccgctcaccatacggtattggtgtccaatgttatcggtgta
gagcgcaatgagttctgtgagccgcagccaccggaagcgggcgctccacgtgctttggaa
agtttatgggatacctggcaggagatgcaggaaccggaaaaccgccgttcactgcgcgaa
tggttgcacgatagccaaatggatttacacgacgtccatacccaatatgctcacggtatg
ctggatctgactcatcgcgcttgggcagagcaactttatctaagcatttgtaatgagatc
caaaaacagttggatccaagcaaccgcgcccaccggcccatcattgatgagctgcaagag
cggatggctgacaagctgtatgtgaatttctcgctgttccagtcaatgccggatgcatgg
ggtatcgatcaactgttcccggtcttgccattggaagggttagataagccgccagagcgc
cgtgcggtattgctggatattacctgtgattctgatggcaccatcgatcactatattgat
ggtgatggggtggcgaccaccatgccaatgccaccgtatgatccggaaaacccgccattg
ctaggcttctttatggtcggtgcttaccaggaaatcttgggtaatatgcacaacctgttt
ggtgacactgcggcggtagatgtttatgtcttccctgatggcacggtagaggttgagcag
accgatgaaggcgatacagtggcggatatgttggaatacgtccaattgaaccctgaaaaa
ttgctggaacatttccgcggtcaggtaaaagaaaccgatctggataccgaattgcaggcg
cagttcctggaagagtttgaggctggcttgtacggctacacatatcttgaagacgaataa

DBGET integrated database retrieval system