KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3369
Entry
y3369             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11901  type VI secretion system protein ImpB
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3369
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3369
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAM86919
UniProt: Q8CK73
Position
complement(3714018..3714521)
AA seq 167 aa
MMSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNI
NKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLA
MRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAPKEG
NT seq 504 nt   +upstreamnt  +downstreamnt
ttgatgtcctcttcaagcttccaaaatgagatacctaaagcacgcattaacatcaaatta
gacctgcatactggcggggcgcaaaagaaagtcgaactgcctttgaagttgttggtgatg
ggcgattacagcaacggtcaggagcagcgcccgctgtctgaacgtgaaaaactcaatatc
aataaaaataattttaacagtgtgctggctgaattccaaccgagcctgaaactcgctgta
ccggacacgctggccggggataacaccgatacagccgtctccctgaccttcaacgacatg
aaagatttcgagccagaaaacgtggcccgtcaaattccgcaactgcgtgccttgctggcc
atgcgcaacctgctgcgagaccttaaatccaatctgctggacaacgccaccttccgccgt
gagctggaaaatatcctcaaagacgatgccttgagcgatgaactgcgcgctgaactggcg
gccctggcgccaaaagagggttaa

DBGET integrated database retrieval system