KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3658Help
Entry
y3658             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11891  type VI secretion system protein ImpL
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y3658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3658
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C ImcF-related_N AAA_16 AAA Rad17
Motif
Other DBs
NCBI-ProteinID: AAM87206
UniProt: Q8CKD9
Position
complement(4062287..4065781)
Genome map
AA seq 1164 aa AA seqDB search
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFS
WIFRYARAPLPKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDA
KPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAG
EWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSSVTERKSLADTLR
LRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNFV
ADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPI
GYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQ
VNDNLVAAYEQLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYV
TNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLF
SYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDAPLPARIEDLSLA
DAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDGK
ASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPS
SPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFS
RLQIDMARQPEPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNR
LASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFEN
SAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGSNQPVKVDWPGPK
GGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKIE
LSSTMKDYPLWSKALAQFSCPKNL
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcagaatgttgattttaatcattgccctagtgctttgttatattgtgtggtgg
atagggccgctgatcgccattggcccctatttccctctggggggggtatgggttcgtaag
atcattattgctctgattttattttgggcactgtggccatttgttgcaattttcttcagt
tggatttttcgttatgcccgtgcgccacttcccaagcgcaagaaaaaaacggttcagctt
gatcgcgtttctgcacgttttcatgatgcgatgctcaccctgcaacatgcggatctttca
agccagaaaacacgctggcagcgctggcgtcaacggcgtaagcgccagtatatcgatgct
aaaccgtggtttctggtcatggggccacccggatgcggtaaaacgtcgatagtttatgag
agtagcgagaagttcctactctcagaacagtatggtttagcgcagaccacggatattgga
ccgacgcaggactgtaattggtggctgacggatcgtgctgtttacatcgatacggcaggg
gaatggatcctgctgcatggtcagagcgaagaagcgggcacggctcggcaaaaattgttc
tctatgatccgcaaatatcgccgttatccgggggttgatgggattgttctttgccttgac
gtcagcgtgcttttgaactcttcggtgacggaacgtaagtcactggctgatacgttgcgc
ctgcggatcctggaagttgcctcgacatttcaggccgatattgcggtgtacttgttcctc
aacaatatcgataagttacctggcggcgaaaccttcctctcgttaatgaacgacgaactt
ctggccggagggcttgggattagcatgacccataatgaaaaggggcagaacaatttcgtt
gccgatgaagaacgttaccgtgaactcctgacacgtgttagccgttatgtgttggaaata
ctgcacgattcgcccaacatggagatgcgccaccaattgctgctgtttacagaaagcctg
ggagcgctacaaaaacccctgtttggcttattcgaacaaatatttccggcgacaccgatt
ggctataccggttgtttgcggcagttctggtttggcagtacccaaaatctgacctcatgg
gaggcgctgtattatccgtcatcgaccagcacctttgaaagccggcctgctgggcagatg
tatttccctgcactgagtcaagcgatcaccgaaaggggggtattacacgccactggcccc
atgcctttgcgaaatcgcctgttaaacatcggtaaatatgtgttcgtggtccttgtgctc
tgcatcttattgttgatgctgagcgcccgctatttttgggaatatgactatattggctat
gcgacagctcggtttgaggaaacccgtcggattgtgcgtgacatcccaatcacgaatcag
gtcaacgataatctggtcgcagcttacgaacagttggggtatatcaacacccattatctg
gaaagttcaccgccactgctgacaccgtacttcgagcaccgtttactgaatcaggcgatg
ttgcaaacctaccatcgtcacctgaataaagtgttctggcctgcggtacaaaactacgtc
accaacgagctgaaaaaggacactcaatctcctgacggtgacaactatgacacgctgaaa
gtttacctgatgctcggacaacctgatcaccgctctcaggaggcattggtgcaatggttt
atgtcgcgctgggaaagttttgcgcctcagggatatgggcaaaacgaccgcaaactcttc
agttatcatttgagtgaactgttttctgacaccgcctcagctgccccgaaagttaagctg
aatgatgagctgatccgtgaatcacgcattaaagcgatgaaaacaccgatacacatccgg
gtgattaatcgtattcatgacgccccactgcccgcgaggattgaggatcttagtctggcg
gatgccgccggtcctagcgtaacactgatgctgagacgtaaaagccccagtacagtaacg
gatttggcgatcccggctttctacactcgggccagctaccacgatgtggttaacccacaa
cttcaggaagcatcggaagcgatgattaacgaggaagcgtgggtgttgagtgacggtaaa
gcttcggttagtcaggttagtttactggctgcggcgcaaaaactgtccgatgaagcgcgc
aagtattatctgatggagtatgccaaccaatgggatgcattcttcaatgatatcagggtg
cgcccaatcaacggacttgatgatgcggcgctgctggcaaggcaactctcagacccgtca
tccccgttggctaatctggtgcgtttctccacacgggaaataaccctgaccactgacaac
aatggtaaaggggcgatgtcgtcaggctggttcaatattcaacgtaataagctcacgact
gcccgccgtaacatcattgacgaaatgtcgggtgagcgttctcgttttcgtctaacgcca
gagaaagcggtggaggatcgctttgaactattaagacgtctgggatatgccctgcaaagt
gcgtctaccagcaattctgatccgttgggccgaaccttcgagcagatttataaccagttg
ataacactctcgacttcccttcgggctgggcagattttgccgcaaaataacgatttcagt
cgcttgcaaatcgatatggcccgtcagccagagccggtgcgcagcattatgatggatctg
ctggccgtcggacaaacgcaaagtctgcaacaaagtaaggccaacctcagcaagggcgtc
tcttcaattgcttctgatttatgtagcaacgccgtcagtggccgttatccctttaatcgg
ttggctagcgaagagataggtattggcgatttcaaccgtatgtttggtcgttctggggcg
atgcaaagcttctttgatcagaatctcgcaccgtatgtcgataccaacggcaaccgctgg
aaggtaaaacctgacagtaacggtgtggtgacccctaaaactctgcgttcgtttgaaaac
tcagcacaaatccgcgacaccttctttgatgcctccggcaagatggcgatgtcgatgatc
attcgccctatctcactgactccatcaattttggaagcggttcttgatgtcgatggccag
attattaactacagccatggttctaaccaaccggtaaaagttgattggccaggaccgaaa
ggtggggtgtatatccgcctgacgttcaaaactcaggatggaaatgtggaaaccgttagc
ttcaatggtccgtgggctattttccgcatgtatgacgttagtaaccctaggccactcggg
gtcaatagccgtgaactcatgatggtgatggataacgtgagtggcgtcttcaaaattgag
ttgagttccaccatgaaagattatccgctgtggtcaaaagcattggcacagttctcatgt
cctaagaatctctaa

DBGET integrated database retrieval system