KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3659Help
Entry
y3659             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11892  type VI secretion system protein ImpK
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y3659
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3659
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: AAM87207
UniProt: Q8CKD8
Position
complement(4065790..4067427)
Genome map
AA seq 545 aa AA seqDB search
MGLATRKARMNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSS
TSQAENYKEGLADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGS
NNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRSWPTRNAAEVRP
PIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAW
GGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLY
GQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNILT
WVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFIN
KKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINE
THQREISAIGRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQG
TNTQQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggggcttgcgacaaggaaggctcggatgaacgaatttgaacgccagatccgtgcagcc
atttccgcagcacgcaatggcgcaaaacatgcggaacagtcactgactacaccaatgtgg
caagccaaaagcaccgtagcctcattgggtgggattgtccctagaagtggctcttcgtca
acgtcacaggcggagaactataaggaaggtctcgcggaccaggctgcctcgggcaacaac
atggcgcgcacgagtgcgccaccggtcactttgtatcagcaacagccaaatgcgaatgac
agctatccaaacgggaataacaacaatccaaacggggataacaacaatccaaacgggagt
aacaacaatatagcgagagtacagcgtatgccgcatggcatttccaggggcttatatgag
cgccctgggatgttattgggtgcctgggataacgcctatattgctgcggctatgcctttg
ctgctgctggtggaaaatattcgtagctggccgacgcgtaacgccgcagaggtcaggcca
ccgattgtgcgggaattacaatatttccagcaacatttgcagaaaaagaactacccgcaa
gaagacattaaccacctgtcttacctgctatgtacctatatcgatggcatttttaacggg
ctgcaaaccccagactcctacaaccaaagtctgttagtggagtttcaccgtgatgcctgg
gggggtgaggactgcttcgaacatctgcgggtctatatgaactcgccgaaacagtaccgg
gaagttctggaattctatgatctgattatgtgccttggttttgacggtaaataccagatg
atagagcatggtgcggttctgctgatggatttacgcagccgtctccacacgcaactctac
ggtcaggacgccacacaatctttggctatcgcgcaagcggtcaaaggttctccgcgtcgc
caatatatcaaggcgctgaaaatcttcacctatggtttcgcactgtgcctttgtgcttac
ggcgtcacggcgtggtatctgcaccagcaatcccaacagatccgcagcaacattctgacg
tgggtactgcctgaaccgcggaaaatcaacatcatggagaccttgccgaatccgctatcc
aacatcctgaatgaagggtggctggaggtcaggaaagatccgcgtggatggctattaatc
ttcacctccgacggcgcgttccgcacgggtgaagcgaccctctcggaagagtttatcaac
aagaagaatatcgaacgtcttgggctggcattagccccatggccgggagatatcgaggtt
attggtcatacggataacaaaccgttccgtagcacttccggtaacaacaacctcaaactt
tccgcggccagagcatcggtggtggcagataaactgcgggaatccactcaaatcaacgaa
acccatcagcgagaaataagtgccatcggacggggggagagcgatcctttagctgacaat
gcaacggaagaagggcgcaagcgtaaccggcgtgtggatatcctatggaaaattggtcag
cgcgatgccgataaggccatgaagcaattcctggagaacccaacaccagaagttcaagga
acgaatacccaacaatag

DBGET integrated database retrieval system