KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3668
Entry
y3668             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y3668
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3668
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3668
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AAM87214
UniProt: Q0WJF8
Position
complement(4073698..4076046)
AA seq 782 aa
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIEL
PDSAGYRTFFTYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQV
FSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTD
QQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQRIHSSEIVLRDFDFLNPRNTLQT
HIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAIQSNGQLLSGESNATGLVPGR
SFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDVVYRPQCVTPP
PKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQH
ASQLTFDDNRGNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDF
SFSVTGMSVSATGISVSTTGTSLSVTGMSTSVTGVSVGFTLIGTSFTGVSTSFTGVGTSF
TGASNSLTGVSNSMTGCSSSFTGTSNSMTGSSHSMTGMSTSITGHSMSQTGSSSSITGDS
TSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTGSSTSTTGNSVSMTGNSTSTT
GCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVGVDLKTVGMQS
KN
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgcaattaattgagatagagaatgaggttttatcgggccaggatgcttttcctctctcc
ttcaagacgcaggaaaaagtgtcagggaatccatcctaccaactggtatttcaggtagca
gaagcggatctcgatctggtcagtttgctgggggaaatcatcaaagtcaggattgagtta
cctgactcagccggctaccggaccttttttacctatgtgatcgccggtgctgatgaaggg
caacggcaagacaaatttgtttacagcctggaactgagtacctggacgtggtttttgatg
caaaaccgcaactgccggatatttcaggacctgaatattatcgatattatcgaacaggta
ttctccaaatataactttgcggattaccgttttgatatcgtcggtaactatcgattacgc
gagtactgcgtacagtttgcagaaaccgatttcgactttgttaatcgtctgatggaagac
gaaggcgtttggtattacttcgaacataacgaagataagcacacgctggtcatgacagat
cagcaacaattccctgtattggaagggcattatgcagaactgagtttcctgcctgacagt
gaagagatgcgcgccatccgtgaggggatacagcgtattcaacgctcacaacgcatccac
tccagcgaaattgtcttacgtgacttcgatttccttaatccacgcaatacattacaaacc
catatcgaagaaagccgccaacacctgcaaggcgtgccactggaatggtatgactacgcg
gcgggttacaccgatccccagcatggtgagagcatcgcccgtttacgccttgaagctata
cagagtaatgggcagctcttgtctggtgaaagtaatgccacaggattagtgccagggcgc
tcttttgctctggtacagcaccctgataacaaccgtaatcggggattcaaactgatcagt
tgtgactacagttttgtccaggatgggccggacagtgcgagccagggacgtaatgtcgcc
tgtaagtttaaggcattgaatgatgacgtcgtttatcgtccacaatgtgtcacgccaccg
ccaaaggtccctggtgtgcaaagtgccacagtggtcggtgcgcgtgaatcagaagtgcat
accgataagttcgcccgtattcgcgttcactttcactgggatcgttataaaaccaccgaa
gatgatagctcctgctggatccgcgttgtacaggcgtgggccggtaaaggctggggcgtc
ctggcgatgcctcgggtcgggcaagaagtgctggtcaattacgttgacggcgaccttgat
cgcccgatggtgaccgggatcgtctacaacggtgagaacccaccgccttaccgtttacct
gaccacattaactactccggttttgtctcacgctcactgcgctttggtcagccacaacac
gccagccagcttaccttcgatgataatcggggcaatgagcggatcatgctacatgctgag
cgcgacttacaaagaacggttgaacgtaacagtgcgacggccgtcggtcaggataaatac
gacacggtggaacggacggccacggagtggatcaacaaccatatctcctacaaagacttc
agtttctcggtgacgggcatgagtgtctccgcgacgggcatcagtgtctcgacaacggga
acgagcttatctgtcaccggcatgagcaccagcgtcacgggtgtcagtgtgggtttcacc
ttgatagggacctcctttacgggggtgagcacatcgtttaccggtgtcggtacctccttc
accggggccagcaactcgctaaccggtgtcagcaactcgatgaccgggtgtagttcctcc
tttaccggtactagcaatagcatgacaggcagtagccatagcatgaccggcatgagcacc
agcatcaccgggcatagcatgagtcagacgggttccagtagcagcatcaccggtgacagt
acctcctttaccggcagcagcgtcagcagtacgggcagcagcgtcagtacgaccggtgtc
agtaccagcactacggggagtagcacctcgactaccggttgtagcgtcagtactacgggt
agcagcacctcgactaccggtaattcagtcagcatgaccggtaacagcaccagtaccacg
ggatgcagtatttccacgacgggcagcagtattgggacggtaggaagcagtatcagcacc
acgggcagtagcgtcagtaccaccggtagcagtatcagcaccacgggattatccgtcagt
tataccggcgctcaatattccgatgtgggtgtcgatctgaaaaccgttggcatgcaaagc
aaaaactga

DBGET integrated database retrieval system