KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3671Help
Entry
y3671             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11896  type VI secretion system protein ImpG
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3671
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AAM87219
UniProt: A0A454XKN8
Position
complement(4079732..4081576)
Genome map
AA seq 614 aa AA seqDB search
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSR
IQQRLNNEHPEFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLS
DSSLNNRLANFSTGRTLKIQPLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQG
VASLSELDFAPMNLTLAGGIIQSNQLITTLLNNTLHIVLWANTDGKPLVKVLTKEHLRQG
GLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGLNDFLQQGDGIHTFEVLFVLD
QRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLNPRLYEVHHVL
GVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVP
NIDQAWRALQLIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAH
NFERHTAPGPIAWSRGVEATLDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQV
DGETFAKWGPVNYG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgaaagttttctggctctatacaacgaagagttgcgttatctgcgtgaagat
gggcagcgcttcgctcatatgcatccgcaagtcgcccaacaccttgggttacatgctgat
ggtgtgctcgatcctttcgtcgaacggctccttgaaggcaccgctttcttgagttcccgt
atccaacagcgtttgaacaacgagcatccagagtttgctttgcaaatgcttgggcgtttg
gccccactttggtatacacccctgccgtcgattgccaccattgccatggttccggatctt
acgtcaccgcaatggcactcgcgcgtcgtattgcctaaaggtagccgcgtgacattgagt
gacagttcgctgaacaaccggttggcgaatttctctactggccgcacgctgaaaatacag
ccattggtcattgaaaatgccgagtgtgccagcacgccaccggcgtatttaccgctctct
gtggcttcacaattacaagctggtcaggcccatctgcgcttgcgtctgaccactcaaggt
gtcgcgtctttatctgagctggatttcgccccgatgaacctgacgctagcggggggaata
attcagtcaaatcagttaatcacgacactgttgaataacaccttacatattgttttgtgg
gccaacacggatgggaaaccgctggtcaaagttcttaccaaagaacatcttcgccaggga
gggctggatgaacaagaggcgcttttacctgttgcgatcagcgaaatgcctggaaaccgt
ttgctacgagaatattttgctgctccttcgcgttttttcgatctggaactgcatggcctc
aacgacttcctgcaacaaggggacggcattcatacctttgaggtgctgtttgtactggat
cagcgccccctacatttgattgatagggtcactggcaatgacttccgactcttcgccaca
cctattattaacctgttcaaacgccgttgtagcccggtgctgattaatggtgaacacacc
gaatatcccgtcattgttgaccccctgaacccccgcttgtacgaagtccatcatgtactc
ggggtcaacggtttgttgagcgaaggggggagcgtgcagttttcttcccttcatggtcat
gcccgttttgatgatgacgataaaatggcgggttacagcattcgccgtcgccgcgacttc
acggataaaaatcatcagaaaaattcacctttacctcatgacagcttattcattgccctt
tcaccggggaccagcgggatagatattgatcacgtcaagtcgctgtcgattgaagccatg
gtgtgcgaacgccacttaattcccagccaattacagcatccggaattcaagctggaaatt
gccctgccagtggggcagatcgaaatgctgcgtcacccggcaaaaccacagggtgtgccg
aatattgatcaagcctggcgggcgttacaactgattgccaacaatccgctgcgttatgcg
ctgccggatgtcaccgattgttcgccgctgctaaaagattggctgtcgatattttgtcag
catgaagaggcgagccagcataagaggatcactagcctgactcacgccagtgtggcgcat
aattttgaacgtcataccgctccggggccgatcgcctggagccggggggttgaagccaca
ctggatttcaacagcagccaccacagtgataaaggtgcattcctctttgcgcggatcctg
catcacgcgctgtcagaatattgtgaattagggcagaccctgaggttacacatgcaggtt
gatggtgaaaccttcgccaaatgggggcctgtcaactatggctag

DBGET integrated database retrieval system