KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3672
Entry
y3672             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11897  type VI secretion system protein ImpF
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3672
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3672
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AAM87220
UniProt: A0A5P8YL33
Position
complement(4081609..4082052)
AA seq 147 aa
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNY
GLPSLSQQVPVITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHA
RCNLPGEEHLVNLRIALDYSYGMVRVL
NT seq 444 nt   +upstreamnt  +downstreamnt
atggatatttcagcaccgatactttttgacaaattaagtctccgccatgaacacgttcgc
ttacctcattggcgtgaagtgattgtgcgcgatattgaatctttattgaatgactccgca
cacagtgcccggttgaagctaaaaaagtatccgcattgtgaggcttctgtattgaattac
gggctgccttcgctcagtcagcaggtaccggtaatcaccgacttgctggaactggccaga
catatacagcggatcatcgccacgtttgagtcacgcctggatccgcgctcaataaaagtg
gtgccgctgattaataaaggcgaaacctgggtgttagccatcctgtttgacattcatgcc
cggtgcaacctaccgggcgaagagcacttggtcaatttacgcatcgcgctcgattactcc
tatggaatggttcgcgttctttaa

DBGET integrated database retrieval system