KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3674
Entry
y3674             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11900  type VI secretion system protein ImpC
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3674
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3674
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-ProteinID: AAM87222
UniProt: Q0WJG4
Position
complement(4082807..4084318)
AA seq 503 aa
MENMQKAQLNDTPDINVDLAENELDDILKRSFRPRTDEASATVRRAIGTLAAYANKGQVK
VNRDVVLTIESLVAEIDEKLSDQMNLILHHKEFQKLESAWRGLSYLVDNTDANETLKIRV
LNISQDELGKTLRRYRGSAWDQSPIFKQVYEHEYGQFGGEPFGCMIGDYEFDHSPQSVAL
LTELAKVAAAAHCPFITSSSPSIMQMNNWRELGNPRDIGKIFTTPEYAPWRRLRESNDSR
YLVLTLPRFLSRLPYGAKNHPIDDFAFEEVVSPHASEDFTWANAAYAMGVNINRAFNEYG
WCSRIRGIESGGSVEELPAYAFPSDEGGYELTCPTELAISDRRENELSNAGFLPLVYRKN
SDFAAFIGSCTLHAPANYDDPDATANARLSARLPYIFATCRFAHYLKCIVRDKIGSFRSR
DDMQLWLNDWVMNYVDGDPSISTEATKAKRPLAAAEVQVEDVEDDPGFYRAHFYLRPHYQ
LEGMTVSLRLVSKLPSNKESEKK
NT seq 1512 nt   +upstreamnt  +downstreamnt
gtggagaacatgcagaaagcccaactcaatgacacgccagacatcaacgtcgatctggct
gaaaacgagttagatgacattttaaaacgttcttttcgccctcgaactgacgaagcttcc
gccacagtgcgccgtgccataggcacgcttgctgcgtatgccaataaaggccaagtgaaa
gtcaatcgtgatgtcgtactgaccattgagtctttagtcgctgaaattgacgaaaaactt
tccgatcaaatgaaccttattctgcaccataaagagttccaaaagctggaatcagcttgg
cgcgggcttagctatcttgttgataatacagatgctaatgaaactttaaaaatacgggta
ctgaacattagccaagatgaactggggaaaacgcttcgccgttatcgtggctctgcatgg
gatcaaagtccgatatttaaacaggtctatgaacatgaatatgggcagtttggtggggaa
ccttttggttgcatgatcggtgattatgaattcgatcacagtccacagagtgtggctctg
ctgaccgagttagccaaggtggccgccgccgctcactgtcctttcattacctcttcttcc
ccaagcatcatgcagatgaataactggagggagctgggtaacccaagggatatcggcaaa
atctttaccacacctgaatatgcgccatggagacgtttacgtgagagtaatgactcccgc
tatctggtactgactctgccacgttttctttcgcgtctgccgtatggtgccaaaaatcat
cctattgatgattttgcttttgaagaagtggttagccctcatgccagtgaggatttcacc
tgggcgaatgcggcctatgccatgggcgtcaatattaaccgggccttcaatgaatatggt
tggtgttcaaggatccgcggtattgagtcgggggggtccgtagaagaacttccggcctat
gcttttccttctgacgaaggcggatatgaactcacttgtccgacagaattggcaatttcg
gaccgtcgtgagaacgagctatccaatgctgggtttttaccgctggtctaccgtaagaac
tcagactttgccgcctttatcgggtcgtgcaccctgcatgcaccggcaaactatgatgac
cccgatgcgacggcgaacgccagattatcggcccgtttaccttacatttttgccacctgt
cgtttcgcccattacctcaaatgtattgtgcgcgacaaaattggttcgttccgctcgcgg
gatgacatgcaactttggcttaacgactgggtgatgaactacgtcgatggtgacccctcc
atttcaacagaagccactaaagctaaacgcccgctggccgctgcggaagttcaagttgaa
gacgtagaggatgatcctggtttttaccgcgctcacttctatttacgccctcactaccaa
cttgaaggtatgacggtttctctgcggctggtttctaaacttccatccaacaaggaaagc
gaaaagaaataa

DBGET integrated database retrieval system