KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3675
Entry
y3675             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11901  type VI secretion system protein ImpB
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3675
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3675
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAM87223
UniProt: A0A2U2H085
Position
complement(4084318..4084878)
AA seq 186 aa
MAKDASSQKFIGRNNAPRVQIEYDVEIYGSNKKVELPFVTGVMADLSGHRAKPLPAVEDR
KFLTFDQDNFDARMRAIKPRLKFYVDNTLSEDNELLDIELDFESMDDFSPGSLARRIPQM
EKLLEARTHLAELITYMDGKTSAEEVVKQLLEQPDFLQNLATDAQGTISKLSQDDDVLVE
DDDGEK
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccaaagatgcgagctcgcaaaaatttatcggtagaaataatgcacctagagtgcaa
attgaatatgacgtcgaaatttatggttcaaataagaaagtagagttgccttttgtaacc
ggcgtgatggctgatctttctggccacagagcaaagcctcttcctgctgttgaagatcgt
aaattccttactttcgatcaggataatttcgatgcccggatgagagcaattaagcctcgc
cttaaattctacgtagataacaccttgagtgaggataacgaactcctggatatcgaactg
gattttgagtcaatggatgacttttcccccggatcgttagcgcggcgtattcctcaaatg
gaaaaactgcttgaggcacgcacccatctggctgaattgatcacctatatggatggtaaa
accagcgcagaagaggtggttaaacaactgcttgaacaacctgattttttacaaaatctt
gcgaccgatgcacagggaactatttcgaagctcagccaggatgatgatgttttagtggaa
gatgacgatggagaaaaatag

DBGET integrated database retrieval system