KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3941Help
Entry
y3941             CDS       T00092                                 

Gene name
cysG
Definition
(GenBank) uroporphyrinogen III methylase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00860  Porphyrin and chlorophyll metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
Module
ypk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    y3941 (cysG)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     y3941 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     y3941 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     y3941 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: AAM87485
UniProt: Q74Y23
Position
complement(4395216..4396664)
Genome map
AA seq 482 aa AA seqDB search
MPCNRLKTEGLPMDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEFTPQ
FHHWADQGQLSLISGEFVPELLADKWLVIAATDQLSVNALVYQSANQQRIFCNVVDDPKR
TSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAGNLRQRVKQHFTV
MTERRRFWEKLLTHDRLAQSLANNDHVQADQHVEQLFSAPLTDRGEVVLVGAGPGDAGLL
TLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQINQILLQQAQ
SGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYSGIPLTHRDHAQ
SVRLVTGHAKKEGQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGMPATTQVALVENG
TSRHQRVVSGELSQLALLSQQVSSPSLIIVGSVVSLREKLNWFSSRHHDDQPKVTECVAH
VG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttgccctgcaacagactgaaaactgaaggattgccgatggactacttcccgatcttctgc
caactgcaacacaaagcctgcctgctggttggcggtggagaaattgctgaacgcaaagcg
cggctgttattggatgcaggtgcgttagtcaccgtcaatgcctgcgagttcaccccccag
tttcaccattgggcagatcaggggcaactttcattaatcagcggtgaatttgtgcccgaa
ctgttggccgataaatggctggtcattgccgccaccgatcagttgtccgtcaatgcatta
gtctatcaaagcgccaaccagcaacggatcttctgcaatgtggttgatgatccgaaacgc
accagctttatcatgccatctattattgatcgctcccccatcatgatcgcggtctcctct
ggcggtaaagcgcccgtgttggcccggttgttacgcgaaaaactggaagccctgttaccg
caacatttggggcaactggcggggaacttacgccagcgggtgaagcagcattttaccgtg
atgaccgaacgtcgccggttctgggaaaagttgctgacccacgaccgtctggcacaatct
ttagccaataacgatcacgtgcaagccgatcaacatgttgaacaactgtttagtgctcca
ctcactgatcgtggcgaagtggtgttggtcggtgcagggccgggagatgctggtttattg
accttaaaagggttgcagcagatccaacaggccgatgtggtggtctatgaccggctggtc
tccgatgaggtgatgaatttggtccggcgtgatgccgagcgcatctttgtcggcaaacaa
tcgggccaccactgtgtgccgcaagagcaaatcaaccaaatcctgttacagcaggcacag
tcaggtaagcgggtagtgcgtttgaaaggtggcgacccgtttatttttggtcggggcggc
gaagagttagaagagttggcgggctacggtattcctttctccgtggtcccaggcattacc
gccgcatccggttgctcggcttacagtggtattccactgactcaccgtgaccatgcgcaa
agcgtgcgactggtcaccggtcatgccaaaaaagagggccagttagattgggcaaatctg
gcggcagagaaacaaacattagttttttatatggggctatcgcaggctggagagatccaa
cagcaattgattcaacatggtatgccagcgaccactcaggttgccttagtcgaaaacggc
acctcacggcatcagcgggttgtgagtggcgagttaagccaattggccttactctcccaa
caggtcagtagccctagcctgattatcgtcggtagcgtggtcagcctacgggaaaaactg
aattggttttccagccgccatcacgatgatcagcccaaagtgactgaatgtgtggctcat
gttggttaa

DBGET integrated database retrieval system