KEGG   Yersinia pestis El Dorado: CH46_2219Help
Entry
CH46_2219         CDS       T03719                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ypl  Yersinia pestis El Dorado
Pathway
ypl00230  Purine metabolism
ypl00240  Pyrimidine metabolism
ypl01100  Metabolic pathways
ypl01110  Biosynthesis of secondary metabolites
Module
ypl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ypl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ypl_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
ypl_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:ypl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CH46_2219 (ndk)
   00240 Pyrimidine metabolism
    CH46_2219 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ypl04131]
    CH46_2219 (ndk)
Enzymes [BR:ypl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CH46_2219 (ndk)
Membrane trafficking [BR:ypl04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CH46_2219 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AJJ16143
UniProt: A0A3N4AYZ7
Position
2446460..2446888
Genome map
AA seq 142 aa AA seqDB search
MALERTFSIIKPNAVANNDIGAIYARFERAGFKIIAAKMLHLTKEQAEGFYAEHKGRPFF
DGLVEFMTSGPIMVQVLEGENAVQRHRDIMGATNPDNALAGTLRADFSDSFTANAVHGSD
AVESAQREIAYFFAADEIFPRS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaacgtactttctcgattatcaaaccaaatgctgttgccaataacgacatc
ggtgccatttatgcgcgttttgaacgtgctggtttcaaaatcatcgccgcaaagatgttg
cacctgaccaaagaacaggccgaaggtttttacgctgagcataaaggccgcccgttcttt
gatggtttggttgaatttatgacctctggccccattatggttcaggttctggaaggcgaa
aatgcggtacagcgccatcgcgatattatgggggcgactaacccagataacgcactagcc
ggtacgctacgtgctgatttttctgacagtttcaccgcgaatgcggtacatggctctgat
gctgttgaatctgctcaacgcgaaatcgcgtatttctttgcggcagatgaaatttttccc
cgtagctaa

DBGET integrated database retrieval system