KEGG   Yersinia pestis El Dorado: CH46_856Help
Entry
CH46_856          CDS       T03719                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ypl  Yersinia pestis El Dorado
Pathway
ypl00540  Lipopolysaccharide biosynthesis
ypl01100  Metabolic pathways
Module
ypl_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ypl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CH46_856 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ypl01005]
    CH46_856 (rfaD)
Enzymes [BR:ypl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CH46_856 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:ypl01005]
 Unusual sugar
  CH46_856 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short ThiF
Motif
Other DBs
NCBI-ProteinID: AJJ13589
UniProt: A0A3N4AWQ3
Position
936848..937780
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDLDIADYMDKEDFVASI
VAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFCLDRSIPFLYASSAATY
GGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQICGFRYFNVYGPREGHKGS
MASVAFHLNNQINAGERPKLFAGSENFKRDFIYVGDVADVNLWFWQNGVSGIFNCGTGRA
ESFQAVADAVVDYHQSGPVEYIEFPEKLKGRYQAYTQADLTKLRAAGYGKPFKTVAEGVK
EYLAWLNRSV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgttacaggcggcgcaggtttcattggcagcaatatagttaaggctctgaat
aatattggctacaaagatattctggtggttgataacctcaaagacggcactaaattcgtc
aatctggttgatctggatatcgctgattacatggataaagaagattttgtcgccagtatt
gttgcgggtgatgacatgggcgatatcgatgctattttccacgaaggcgcgtgttcttcc
accaccgagtgggatggcaagtacatgatggataacaactatcagtattctaaagatatc
cttcacttctgtctggatcgtagtattcctttcttatacgcctcttctgccgccacttac
ggtgggcgcactgacaactttattgaagatcgtcagtacgaacagccacttaacgtttat
ggctattccaaattcttgtttgatcagtatgtgcgtgaaattctgccacaagccgattcg
caaatttgtggattccgttatttcaacgtttatggtccacgtgaaggccataagggcagc
atggccagcgtcgctttccatctgaataaccaaattaatgcaggtgaaaggcctaagtta
ttcgcgggtagcgaaaactttaaacgtgatttcatttatgtgggtgatgttgctgacgtt
aatctgtggttctggcaaaacggcgtatccggtattttcaactgcggtactggccgggca
gagtctttccaggctgtcgctgatgcagtggtggattatcaccaaagtgggccagtcgaa
tacatcgagttccctgaaaaactgaaaggccgctatcaggcatatacacaagccgatctc
actaaattacgggctgccggttatggtaaaccgtttaaaacggtcgctgaaggcgttaaa
gaatatctggcctggctcaatcgctcagtctaa

DBGET integrated database retrieval system