KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0212Help
Entry
YP_0212           CDS       T00165                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YP_0212 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypm03011]
    YP_0212 (rplV)
Ribosome [BR:ypm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    YP_0212 (rplV)
  Bacteria
    YP_0212 (rplV)
  Archaea
    YP_0212 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: AAS60488
UniProt: Q8ZJA7
Position
223410..223742
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctaacctacaccaac
aaaaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagatcttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system