KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0728Help
Entry
YP_0728           CDS       T00165                                 

Gene name
phoR
Definition
(GenBank) phosphate regulon sensor protein PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YP_0728 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypm01001]
    YP_0728 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypm02022]
    YP_0728 (phoR)
Enzymes [BR:ypm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YP_0728 (phoR)
Protein kinases [BR:ypm01001]
 Histidine kinases
  OmpR family
   YP_0728 (phoR)
Two-component system [BR:ypm02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   YP_0728 (phoR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoR HATPase_c HisKA PAS HATPase_c_2 HATPase_c_3 PAS_8 PAS_9 PAS_4
Motif
Other DBs
NCBI-ProteinID: AAS60994
UniProt: A0A3N4BC67
Position
787671..788987
Genome map
AA seq 438 aa AA seqDB search
MLERLSWKTLALELALFCLPALLLGAFIGYLPWLLLVSVVAALTWNFYNQLKLSHWLWLD
RSMTPPSGRWSWEPLFYGLYQMQLRNRRRRRELALLIKRFRSGAESLPDAVVITTVDGNI
FWCNGLAQQLLGFRWPEDNGQHILNLLRYPEFSQYLQQQTFSRPLTLQLNNGYYVEFRVM
PYSEGQLLMVARDVTQMRQLEGARRNFFANVSHELRTPLTVLQGYLEMMHDQELAGPLRD
KALGTMQEQTKRMDGLVKQLLTLSRIEAAPNVDLNERVDIPLMLKILQHEVQALSNGRHE
ITFRVNDQLKVFGNEDQLRSAVSNLVYNAVNHTPEGTKIEVCWQQTPQGAQFQVSDNGPG
IPPEHVPRLTERFYRVDKARSRQTGGSGLGLAIVKHALSHHDARLEVMSEIGLGTRFIFT
LPNRLIVPTVLVENAVKS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaacgcttatcatggaaaacgctggctttagagctggctcttttttgtttgcct
gcattattactgggggcgtttattggttatctcccttggttattgctggtttcagtggtc
gccgcgctgacgtggaacttttataatcaactcaaactctctcattggttgtggcttgat
cgcagtatgacaccgccgtcggggcgttggagttgggaacccctattttacggcttatat
cagatgcaattgcgcaaccgcaggcgtcggcgcgaactggcgcttttaattaagcgtttt
cgcagtggtgcagagtcactgcctgatgccgtggttatcaccacggttgatggtaatatt
ttctggtgtaatggtttagctcaacaattgttggggtttcgctggccagaggataatggg
cagcatattctcaatttattgcgctacccggaatttagccaatatctgcaacaacaaacg
ttttcccgcccactgaccttgcaattgaataacggttactacgtggagtttcgcgtgatg
ccttattctgaagggcagttactgatggtggcccgtgatgtgactcaaatgcgccagttg
gaaggtgcaagacgtaacttttttgccaacgtcagccatgaattacgtacgccgctgacg
gtgctgcaaggctatctggaaatgatgcatgaccaagagttggccgggccgttacgcgat
aaagctttggggacgatgcaagagcagactaagcgtatggatgggctggtgaagcaactt
ttgacattatcacgtatcgaagccgcaccaaatgtggatttaaatgagcgggtggatatt
ccgctgatgttgaaaatattgcagcatgaggtacaggcactgagcaatggccgccatgag
attactttcagggttaacgatcaattaaaggtattcggtaacgaagaccaactgcgtagc
gcggtatcgaatctggtctacaacgctgtaaatcatacgcctgaagggacgaaaattgag
gtctgctggcaacaaacaccacaaggtgctcaatttcaagtcagcgacaacgggccgggg
atccctcctgagcatgttcctcgccttacggagcgcttctatcgggtcgataaagcccgg
tcacggcaaacggggggcagtgggttggggttggcaatcgtgaaacatgctctgagtcac
catgatgcgcgtttggaggtgatgagtgaaattggtctgggtacccgttttatttttacc
ttaccgaacaggttgattgttccaactgttttagtcgagaatgcagtcaaatcttaa

DBGET integrated database retrieval system