KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0877
Entry
YP_0877           CDS       T00165                                 

Definition
(GenBank) putative dehydrogenase
  KO
K09911  uncharacterized protein
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    YP_0877
SSDB
Motif
Pfam: MatP MatP_C RHH_4 PPS_PS TMF_TATA_bd
Other DBs
NCBI-ProteinID: AAS61134
UniProt: Q8ZG78
Structure
PDB: 
3VEA 3VEB

Position
942071..942565
AA seq 164 aa
MLGLSYTVTEELTMKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKL
ENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVL
ARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDKEV
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcttggcttaagttacacggtcactgaagagctcacgatgaaatatcaacagctggaa
aatcttgagagtggttggaaatgggcgtatttggtcaaaaaacaccgtgaaggtgaagcc
attacccgccatattgaaaacagtgcagctcaagacgcagtagagcaactgatgaaactg
gaaaatgaaccagtaaaagtgcaagagtggattgacgcgcatatgaatgtcaatctggcg
accagaatgaaacagactattcgtgcccgtcgtaagcgccactttaatgccgagcaccag
catacgcgtaagaagtcgatcgacctggagtttttggtttggcagcgattggcagtatta
gccagacggcgtggtaatacgctttcagatactgtggttcagttgattgaagatgctgag
cggaaagagaaatatgccagccagatgtcttctttgaagcaggacttgaaagatatttta
gataaagaagtttaa

DBGET integrated database retrieval system