KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0886Help
Entry
YP_0886           CDS       T00165                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00010  Glycolysis / Gluconeogenesis
ypm00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_0886 (bglA)
   00500 Starch and sucrose metabolism
    YP_0886 (bglA)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     YP_0886 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AAS61142
UniProt: A0A0H2W2F2
Position
complement(950434..951870)
Genome map
AA seq 478 aa AA seqDB search
MSYQQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGSHGVDRVMTDGVLEGYRYP
NHEAVDFYSHYKEDIALFAEMGFKCFRTSIAWTRIFPHGDEQQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMARYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETLYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILQEWARRGFNIHMEEGDLE
TLRDGCADYMGLSYYMSNAVSAINPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVAADGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKLSFDWYKKVIASNGEVL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaacagttaccgaaagattttttatggggtggcgcggttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggcgtgagcattgctgatgtcctctctggt
ggctcccatggggttgaccgtgtgatgacagacggagtactggaagggtatcgttatcca
aaccatgaagcagttgatttttatagccattacaaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgtttccgcacctcaattgcctggactcgtatcttcccgcatggcgat
gaacagcaacccaatgaagccggcctgcaattttatgacgatatgttcgatgaattgctg
aaatacggtattgaaccggtgattacgttatctcacttcgaaatgccgtggcatctggtc
aaagaatatggtggctggaaaaaccgtaaagtggtcgatttctttgtaaaattcagtgaa
gtcgtcatggcgcgctacaaaagcaaagttaaatattggatgaccttcaacgagataaat
aaccagcgtaactggaaatatccactgtttggttattgctgttctggtgtggtgttcact
gaacaagagaacccagaagagaccctgtatcaggtactgcatcatcagtttgttgccagt
gccaaagtggtcaagctgggtcatgccattaatccggaatttaagattggctgtatggtg
gcgatggtgcctctgtatcctttctcctgccatccagatgacatgatgtattccgttgaa
gctatgcgtgagcgttatcttttcggcgacgttcatatgcgcggttattacccttcatat
attttacaagagtgggcgcgccgtggtttcaatatccatatggaagagggggacctcgag
actctgcgtgatggttgcgccgattacatggggctgagttattacatgagtaacgcggtc
tctgcgattaatccaggtagcggcaattcactctctggttttgagggcagcgtgccgaac
ccacacgtcaaagcctctgattgggggtggcagattgatccggtaggtctgcgttactct
ctgagtgtgttgtatgaacgctatcagaagccgctatttattgttgaaaatggttttggt
gcgatagataaagtggcagcggatggcatggtgcacgacgactaccgcattgcttatcta
aaagcccatatcgagcagatgaaaaaagcggtatttgaagatggcgtggatctaatgggt
tataccccatggggatgtattgactgcgtatctttcactaccggtgaatacagtaaacgt
tatggctttatttatgtcgataaaaacgatgatggcaccggtacaatggcgcgttcacgt
aagttaagttttgattggtataaaaaagttattgccagcaatggtgaagttctttaa

DBGET integrated database retrieval system