KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1025Help
Entry
YP_1025           CDS       T00165                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00010  Glycolysis / Gluconeogenesis
ypm00260  Glycine, serine and threonine metabolism
ypm00680  Methane metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
ypm01230  Biosynthesis of amino acids
Module
ypm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypm_M00002  Glycolysis, core module involving three-carbon compounds
ypm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_1025 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YP_1025 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YP_1025 (gpmA)
Enzymes [BR:ypm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YP_1025 (gpmA)
Membrane trafficking [BR:ypm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YP_1025 (gpmA)
Exosome [BR:ypm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YP_1025 (gpmA)
  Exosomal proteins of melanoma cells
   YP_1025 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAS61275
UniProt: Q8ZGY5
Position
1103732..1104568
Genome map
AA seq 278 aa AA seqDB search
MIRLIERSQRTCSLKYDGHIPNLIGVNVMAVTKLVLVRHGESQWNNENRFTGWYDVDLSE
KGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILDELDQAWLPTEKTWKLNERHY
GALQGLNKSETAEKYGDEQVKQWRRGFAITPPALEKSDERFPGHDPRYAKLTDAELPTTE
SLALTIERVIPYWNDVIKPRIASGERVIIAAHGNSLRALVKYLDDLGEDEILELNIPTGV
PLVYEFDENFKPIKHYYLGNADEIAAKAAAVANQGKAK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgattcggctgattgagcgcagccaacgcacatgcagcttgaagtatgacgggcatata
ccaaacttaattggagtcaacgttatggcagtaactaagctagttttggtacgacacggc
gaaagtcaatggaacaacgaaaaccgcttcaccggttggtatgatgttgatctgtctgaa
aaaggccgttctgaagcaaaggcagcgggtaagctgttaaaagatgaaggcttcactttt
gatttcgcctacacctcagtattaaaacgcgctatccacaccttgtggaacattttggat
gaattagatcaggcatggctgccaacagaaaaaacctggaagcttaacgagcgtcactac
ggcgcactgcaaggcctgaataaatctgaaacggctgaaaaatacggcgatgagcaggtt
aagcaatggcgtcgtggctttgccatcacccctccagcactggagaaaagcgatgagcgt
ttcccaggccatgacccacgttatgcaaaattgactgatgctgagctgccaaccacagaa
agcttggcgctgactattgaacgcgtgattccctactggaatgacgttatcaaaccacgt
attgccagcggtgaacgcgtaattattgctgctcacggtaactctttacgtgcattggta
aaatatctggatgatctgggcgaagacgaaattcttgagctgaacatcccaactggcgtg
ccattagtgtatgagtttgatgagaacttcaagcctatcaaacactactatctgggtaac
gctgatgaaatcgccgctaaagctgcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system