KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1081Help
Entry
YP_1081           CDS       T00165                                 

Gene name
fur2
Definition
(GenBank) ferric uptake regulator
  KO
K03711  Fur family transcriptional regulator, ferric uptake regulator
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypm03000]
    YP_1081 (fur2)
Transcription factors [BR:ypm03000]
 Prokaryotic type
  Helix-turn-helix
   Fur family
    YP_1081 (fur2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR SR1P PadR HTH_12
Motif
Other DBs
NCBI-ProteinID: AAS61329
UniProt: P33086
Position
1155482..1155928
Genome map
AA seq 148 aa AA seqDB search
MTDNNKALKNAGLKVTLPRLTILEVLQNPACHHVSAEDLYKILIDIGEEIGLATVYRVLN
QFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSNESIESLQREIAKQHGI
KLTNHSLYLYGHCETGNCREDESAHSKR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacaacaaagccttaaaaaacgctggccttaaagtcacactcccccggctt
acaattctggaagtgttgcaaaatcctgcgtgtcaccacgtcagcgcggaagatctttat
aaaatactgatcgatattggtgaagagattggcttagcaacggtttaccgtgttctgaac
caatttgatgatgctggtattgttacccgccacaatttcgaagggggtaaatcagttttt
gagctgactcaacaacatcaccacgatcacctaatttgcctggattgcggcaaagtgatc
gagtttagcaacgaatccattgaatcacttcaacgtgaaattgctaaacaacatggcatc
aagctgactaatcatagcctgtatttatacggtcactgtgaaaccggcaattgccgtgaa
gatgagtctgcacacagtaaaagataa

DBGET integrated database retrieval system