KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1361Help
Entry
YP_1361           CDS       T00165                                 

Gene name
hcp3
Definition
(GenBank) Hemolysin-coregulated protein (uncharacterized)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_1361 (hcp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_1361 (hcp3)
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_1361 (hcp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AAS61603
UniProt: A0A3N4B2T1
Position
1491179..1491670
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFV
FTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHD
VKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagacgacggcggtgcggacatcaagggttct
gttgatgtgcaaagccgtgaaggcagcattgagatcgtggcacaggaccataacctgtac
atcccaaccgataacaataccggcaaactgaccggtacccgtatccacaccccgttcgta
ttcaccaaagaaatcgatgcgtcgaccccgtacctgtacaaagcggtgaccaccggtcag
acactgaaaaccgccgagttcaaatggtaccgcattgatgacgctggccaggaagttgaa
tatttcaacaccaaactggaaaacgtcaaagtggttaaagttgcgccgaaaatgcacgac
gtgaaagatccggcgaaagagaagcacaaccacctggaactggtggaactgcgctacgaa
aaaatcacctggacctttaaagacggcaacatcattcattccgattcgtggaacgagcgc
gccaccgcatag

DBGET integrated database retrieval system