KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1375
Entry
YP_1375           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_1375
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_1375
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AAS61616
UniProt: Q0WGT7
Position
1513620..1515383
AA seq 587 aa
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIG
ERETRCRYTTTQEMDLLPLTLRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYF
DADAPLACALHEALTLNTAKLWIRLPGQADRQPLDGHFAPLGFGEQDTLWPKADSAFSGY
QLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLEKRWQHDFSFSEKNLRLHCVP
VINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQVYVPFTSFRH
KGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAE
VLRGTLALYDWTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGD
ICLFGEMLSRFFALYTDIHLFNRLTLILQPTGERLEWEENHQSRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgacttaaccctgcgttattttgacgctgaaatgcgctacctgcgcgaagcgggc
gaagagtttgctcgtgcgcaccctgatcgggctgccggattaaatctggataaagccggg
gcgcgtgacccctatgtcgaacgcctatttgaaggctttgcctttctgatgggccgactg
cgggaaaaactggatgacgacctgccggaactgaccgaagggttggtcagcctgctgtgg
ccgcactacctgcgtaccattccgtcgctttctattgtggagttcaccccacaatggcag
gggatgaaagagcgcatgggggtgagtaaaggttttgaagtgctgtcccgccccattggt
gaacgtgaaacccgttgccgctataccaccacgcaagagatggacctgctcccgctgacc
ctgcgccgtgccgggctggacagtgaacccgatggccggtcggttatccggctgcgcttt
gattgcagcgcgctggccgactggagccgtatcaacctgagccgcctgccgctctatttt
gatgccgatgcgccgctggcctgcgccctgcatgaggcgctgaccctgaataccgccaaa
ctctggatccgtttgccggggcaggctgatcgccagccgctggacggccatttcgcgccg
ctggggttcggggagcaggatacactgtggccgaaggccgacagtgcgttcagtggttat
cagctcttgctggagtactttaccttccgcgaaaagtttatgtttgtcgcgttgcagggg
ctggatgggatcgagctgccggcggaactgccgtggtttgagattgatgtggtgctggaa
aaacgctggcaacatgatttctcgttctccgaaaagaacctgcgcctgcattgtgtgccg
gtgattaacctgttcccgctggaatcggacccgctgtcactttcttcattacagaccgaa
tacctgctgcgcccaatgcgcattcaggacggttataccgaagtgtattcggtggactcg
gtgatctcctcccgtcataccgggcatcaggtctatgtccctttcaccagctttcgccac
aagggggggatgttgcgccatgatgcgccggagtattactaccatacgcgggtcaaacgc
gggccttcggggttacacgatacctggctggtgctggggggcgaggcgtttgataaccac
agcgtaccggataatgaaaatttgtcgctgagcctgaccggcaccaacgggcagttaccg
cgtaaagcgctgcaaagcacggtgctggatacggcggtgaaatccaccggggctcaggtg
cgggtgcgtaatctctccgcgccgtcattgccatgctacccgccgaaccgcgaccgtttt
cactggcgggtgctgagccatctgggcagtagttttctgtggatgatggataacgccgaa
gtgctgcgcggcacgctggcgctgtatgactggacggacaacgaaatgaaccgccgtcgg
ctggaggcgatcgccgaggtcaaacacagcgagattgaacgctttgagcggggctatttg
ctgcgcggggtgcacattgaaatcaccctcgacagcaacggctttaccggtaccggggat
atttgtctgtttggggaaatgctcagtcgcttctttgccctgtataccgatattcacctg
tttaatcgtctgactctgatactgcaaccgacaggagaacgtttggaatgggaagagaat
catcagtcccgccttcccggctaa

DBGET integrated database retrieval system