KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2003Help
Entry
YP_2003           CDS       T00165                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein TrpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01130  Biosynthesis of antibiotics
ypm01230  Biosynthesis of amino acids
Module
ypm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YP_2003 (trpC)
Enzymes [BR:ypm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YP_2003 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     YP_2003 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI CEP44 QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAS62219
UniProt: Q8ZEG8
Position
complement(2225445..2226872)
Genome map
AA seq 475 aa AA seqDB search
MQETGGYKTEGYNVGSDKVDSDKTKTVLHQIVHDKEIWVAARKLQQPLTRFQNEITQSQR
DFYHALQGDKTVFILECKKASPSKGVIRDNFNPAEIAGVYKHYASAISVLTDEKYFQGSF
DFLPQVSAAVTQPVLCKDFIIDAYQIQLARFYHADAILLMLSVLDDEAYRQLAAVAHSLN
MGVLTEASNAEELERAITLGAKVVGINNRDLRDLSIDLNRTRELAPRLPEGVTIISESGI
SHYRQVRELSQFANGFLIGSALMSEPDLNAAVRRVLLGENKVCGLTRAQDAATAYHAGAV
YGGLIFVDSSPRYVDIASARTVISGAPLKYVGVFRHAEIETVRQTAEQLSLAAVQLHGHE
DQQYINQLRKVLPADCQIWKALSVGDTMPERNLQQVERYVLDHGTGGTGQRFDWSLLADQ
ALDNVLLAGGLGPDNCDVAAQLGCAGLDVNSGVESAPGIKDPQRIAAVFQALRVY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaactgggggttacaaaaccgagggttataacgttggcagtgacaaagttgac
agtgataaaaccaaaaccgtgctccaccaaatcgtacacgataaagaaatttgggttgcc
gcgcggaaactgcaacagcctctaacccgcttccaaaacgaaatcacccagagtcagcgc
gatttttatcacgcgctacaaggcgataaaacggtctttattttggaatgcaaaaaagcc
tcaccttctaaaggggttatccgtgacaactttaacccggcggagattgccggtgtttat
aagcactatgcgtcggctatctcagtattaacggatgagaaatatttccagggcagtttt
gatttcttgccacaagtcagtgccgccgtcactcagccggtattgtgtaaagattttatt
attgatgcttatcagattcagctagcgcggttttaccacgctgacgccattttactgatg
ctgtcggtcttggacgatgaggcttaccgccaattggccgccgtcgcacacagcctgaac
atgggggtgttgaccgaagccagtaacgccgaagaattggagcgtgctattaccttgggt
gccaaagttgttggcatcaataaccgcgacctgcgtgacctgtctatcgatctgaatcgc
acccgtgaattggcaccacgcctaccagaaggtgtcacaataatcagtgaatctggcatt
agtcattatcgtcaggtccgtgaattgagccaatttgccaacggtttcctgattggcagt
gccctgatgtccgaacccgatctcaacgcggccgtccgccgggtgttactgggcgaaaat
aaagtttgcggcctgacacgcgcacaagatgccgccacggcttaccacgcaggtgcggtg
tacggcgggttgatttttgtcgacagttcaccccggtatgtggatatcgccagcgcccgt
acggttatcagtggtgcgccgctaaagtatgtcggtgtttttcgtcatgctgaaatagaa
actgtacggcaaacggctgaacaactctcactggcagcagtgcaattgcatgggcatgaa
gatcaacagtatatcaatcaactgcgcaaagtattacctgcggattgccagatttggaag
gcactgagtgtcggtgacacgatgccggaacgcaacttacagcaagttgaacgctacgta
ttggatcacggtacgggtggcacagggcaacgtttcgactggtcattattggcagatcaa
gcactagataatgtcttgctggcaggcggcttggggccagataactgtgatgtggcagcc
caactaggctgtgccgggctggatgtcaattccggcgtagaaagcgcccctggcatcaaa
gacccccaacggatcgccgctgtattccaggcattacgcgtgtactga

DBGET integrated database retrieval system