KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2369Help
Entry
YP_2369           CDS       T00165                                 

Gene name
aat2
Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00220  Arginine biosynthesis
ypm00250  Alanine, aspartate and glutamate metabolism
ypm00290  Valine, leucine and isoleucine biosynthesis
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01130  Biosynthesis of antibiotics
ypm01210  2-Oxocarboxylic acid metabolism
ypm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YP_2369 (aat2)
   00290 Valine, leucine and isoleucine biosynthesis
    YP_2369 (aat2)
   00220 Arginine biosynthesis
    YP_2369 (aat2)
Enzymes [BR:ypm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     YP_2369 (aat2)
    2.6.1.66  valine---pyruvate transaminase
     YP_2369 (aat2)
Amino acid related enzymes [BR:ypm01007]
 Aminotransferase (transaminase)
  Class I
   YP_2369 (aat2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AAS62574
UniProt: Q8D0T1
Position
2636822..2638114
Genome map
AA seq 430 aa AA seqDB search
MASEYIEHLAVFHAEDTLLPAKGSFFMSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNK
VLKLNIGNPAPFGFDAPDEILVDVIRNLPTAQGYCDSKGLFSARKAIMQHYQARNIRDLT
VEDIYIGNGVSELIVQSMQALLNLGDEMLVPAPDYPLWTAAVSLSSGKAIHYMCDEESGW
FPDLDDIRSKITPRTRGIVIINPNNPTGAVYSKELLLEIVEIARQNDLIIFADEIYDKIL
YDDAQHHSIAALAPDLLTVTFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASM
RLCANVPMQHAIQTALGGYQSISEFIQPGGRLYEQRDRAWELINQIPGVSCVKPQGALYM
FPRIDQKRFNLKDDQKLVLDLLLQEKVLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRK
LGRFLETYHQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcggagtacattgagcaccttgcagtgttccacgctgaggacacgcttttacca
gcaaaaggctcattttttatgtcccccattgagaaatccagcaaactggacaacgtctgt
tatgacattcgtggaccggtgctaaaagaagctaagcgtcttgaagaggaaggtaacaag
gttctgaaactgaacatcggcaaccctgccccgtttggtttcgatgcacccgacgagatt
ctggtggatgtaatccgtaatttaccgaccgcacaaggctattgcgactccaaaggcttg
ttttcggcacgtaaagccattatgcaacactatcaagcccgcaatatccgtgatctgacg
gtcgaggatatctacattggaaacggtgtttccgagttgatcgttcaatccatgcaagca
ttactgaatttgggtgatgaaatgctagtacccgcaccggattacccgctgtggacagct
gccgtgtcgctctcaagtggtaaagcgattcattatatgtgtgatgaagagtcaggctgg
ttccctgatttggatgatattcgcagcaaaatcactccgcgtacccgtgggattgtgatt
atcaacccgaataacccaaccggtgcggtatacagcaaagagctgctgttagaaattgtt
gaaattgctcgccagaatgacctaattattttcgctgatgagatctacgataaaattttg
tatgacgatgctcagcaccattcgatcgccgcattagcccctgatttgctgaccgttacg
ttcaatgggctgtctaaaacataccgtgttgcgggtttccgccagggctggatggtgttg
aacgggccgaaaaagcacgctaaagggtatattgaaggcttggaaatgctggcatcgatg
cgtttgtgcgccaacgtaccaatgcagcatgcgattcaaaccgccttgggcggctatcag
agcattagtgagtttatccaacctggtggccgtttgtacgagcagcgtgatcgggcctgg
gagcttatcaaccaaatccccggtgtttcctgtgtgaaacctcagggcgcgttgtatatg
ttcccacgtattgatcagaaacgttttaacctgaaagacgaccagaagttggtattggat
ctgttgttgcaagagaaagtgctattggtgcaaggtagcgcctttaactggccgtacccg
gaccatgtgcggatcgtcacgctgccacgggtggatgagctagagatggcggtgaggaag
ctggggcggttcttagagacgtatcatcagtaa

DBGET integrated database retrieval system