KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2418Help
Entry
YP_2418           CDS       T00165                                 

Gene name
paaJ
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00071  Fatty acid degradation
ypm00280  Valine, leucine and isoleucine degradation
ypm00281  Geraniol degradation
ypm00362  Benzoate degradation
ypm00592  alpha-Linolenic acid metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01212  Fatty acid metabolism
Module
ypm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YP_2418 (paaJ)
   00592 alpha-Linolenic acid metabolism
    YP_2418 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YP_2418 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    YP_2418 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YP_2418 (paaJ)
   00642 Ethylbenzene degradation
    YP_2418 (paaJ)
Enzymes [BR:ypm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     YP_2418 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAS62623
UniProt: Q8ZD46
Position
complement(2688403..2689713)
Genome map
AA seq 436 aa AA seqDB search
MSKPLPLVTRQGDRIVIVNGLRTPFAKQATAYHGVPAVDLGKIVVSELLARSGISSELID
QLVFGQVVQMPEAPNIAREIVLGTGMSVHTDAYSVSRACATSFQAVANVAESIIAGSVDI
AIAGGADSSSVLPIGVSKALARTLVDANKARSLSQKLKLFSRLRLRDLLPVAPAVAEYST
GLRMGDTAEQMAKTYGISREDQDALALRSHQLAAEAWQQGWLHDEVMTAYIPPYREAIIE
DNNIRKDSTLAQYAKLRPAFDRQHGSVTAANSTPLTDGAAAVLMMSESKAKALGLPPLGY
LRSFAFSAIDVWQDMLLGPSYATPLALDRAGITLADLTLIDMHEAFAAQTLANLKMFASD
TFAREKLGRSQAIGEVDMSKFNVLGGSIAYGHPFAATGARMITQTLNELRRRGGGLGLTT
ACAAGGLGAAMILEVE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagccattaccgttagtgacgcgtcagggcgatcgcattgtaatagttaacggc
ctgcggacccctttcgccaagcaggcaactgcttaccatggcgtacccgctgtagattta
ggcaaaatagtggtcagtgaattgctggccagaagtggcatttcttctgagttgattgat
caactggtttttggccaagtagtgcaaatgcctgaagcacctaatattgcccgcgaaatc
gttttgggtactggcatgagcgttcataccgatgcttacagcgtttcccgcgcctgtgcg
accagttttcaggcggtggccaatgtcgcggaaagtattattgctggctccgttgatatc
gcgatagccggcggggcagattcttcatccgtgctgcccatcggcgtcagtaaagccctg
gcccgcacactggttgacgccaacaaggcccgcagtttatcccagaagttgaaattgttt
agccgacttagattacgtgatctgttgccagttgcacctgcggtggcagagtattcaacc
ggcctgcgcatgggggatactgccgagcagatggcaaaaacctatggcatcagccgtgag
gatcaggatgctttagcgctgcgatcccaccaattggccgctgaagcctggcaacagggg
tggctgcacgatgaggtgatgacggcttatattccgccttatcgagaggccattattgaa
gataacaatatccgcaaagattccacattggcgcaatatgccaaattacgtccggcgttt
gatcgtcagcacggtagtgtgacggcggcgaacagtactccgttgacggacggggcggcg
gcagtactcatgatgagcgaatcaaaagccaaagctctggggttgccgcctttgggctac
ctgcgcagttttgccttctctgccattgatgtttggcaggatatgctgttagggccatcc
tatgccacgccattagcgttagaccgggcgggtattacactggcggatttgacacttatc
gatatgcatgaagccttcgccgcacaaacactggctaacctgaaaatgtttgccagtgat
acttttgctcgcgaaaaactggggcgtagccaagccatcggagaggtggatatgagtaaa
ttcaacgtattggggggttccattgcatatggccacccatttgccgctactggcgctcgg
atgataactcaaacgctgaatgagttgcgtcgccgtggcgggggattgggcttaaccacc
gcctgtgctgctggtgggttaggtgctgcgatgattctggaggtggagtga

DBGET integrated database retrieval system