KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2442Help
Entry
YP_2442           CDS       T00165                                 

Gene name
icmF2
Definition
(GenBank) putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_2442 (icmF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_2442 (icmF2)
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_2442 (icmF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: AAS62645
UniProt: Q8CLD8
Position
complement(2711872..2715450)
Genome map
AA seq 1192 aa AA seqDB search
MIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHKKAA
KPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTA
LILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGIL
KALKKYRPVKAINGVIVAISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTI
TKLDQISGFDEYFRNLTAEDREQIWGVTFPYNEAKEQSDMPLQQRISHELALLEDRISNN
MHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQNVFFASRFDETKFHTTLRGIYFVS
SCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISDVAYGKQYFLKQLF
SDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQATGAK
LSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGAN
TLYQFFLQKYLFPMVENQSEVTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHV
TQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARL
WGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDELLHEGIPGLYTYAGYHEVVKKKLT
PLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQGYAAYWKRFLSSVRLISVDADSA
EYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEINIRTQGQLLSQAK
KLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGTLND
QYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITH
TSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTS
SIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPTITQLIMNFD
GNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKASAMPDILFRGPWALLQWADQADEI
RDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMNGIW
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
gtgattggcccattcatattagttggtgatgatcatcctctgactgatgggatccgtcgc
ggcatcattatcgccatcattgcatttattacacttatttatggcacctggtgcttagtc
aaagcattggcgaaaaatccagcgttactggataacttcattaagcacaagaaagcggcc
aagcctgaagcggaggctgaactttctgaagttaatgcgatgatccgcaatggcatgaac
tatgtgcgccgtattcacagtggtattccggcctggcgacgtttctttatctccaaccgt
tggcgcacagaactgccttggttcatggttgtcggtatgaaaggtgcagggaaaaccgcc
cttatcctctcttcaggacaggactttcctttacctgagcagctgaatcgtattggcaaa
gaaaacccacccactcaacattgtgaatgtttgttctctaatgacgccctgtttttagac
acttcagggaaatacattgatgacagcaaagataatcagactgagtggaccgggatatta
aaggcactcaaaaaatatcgtccggttaaggcaattaatggtgtcattgttgcgatttcg
gcatccgatatcttgggtaaaagtaaagctgatttactgaatgtgtcggcgacgctacgc
acgcgtttggatgaggtacgtgcggtcttgggcgtccgtttcccggtgtatgtcacgatt
acaaaactggatcaaatatcgggttttgatgaatatttccgtaatttaacggctgaagat
cgcgagcaaatttggggggtgactttcccttataacgaggcgaaagagcaatccgatatg
ccacttcagcaacgtatcagccatgagctggcactgcttgaggatcgtatcagcaataat
atgcacgtccgccagcaggaagagtatgccgtggcggacagaaaaggcatgtatgcactc
cctcaggatttcaggatgctctcccagagggtaacggaagttttacagaatgttttcttc
gcctcacgctttgacgaaacaaaatttcacacgaccctgagagggatctattttgtcagc
agttgtcagcctgcggatgttgaactgttaaataacaacacgctgattcaaaagtggcgt
aacgttattaatcataaaaaaccgttatcgccagccgatttatcacaaaaaagtgataat
gaagatcggtttattagcgatgtggcttacgggaaacaatatttcctcaagcagttgttt
agcgatgtgattaccaaagatgccgacttagtcagctataacctgaaagtacaatccaaa
taccgttttcagaatctattgggacacgcggcttgtattgggttggcagtttggctggtt
tgggccttcttggtcagcttccagcataacgaggggtatttacaggcgaccggtgccaag
ctgagtcagttagaaagcacggtgatgagttatgccaaaacgtccaatgagcagatctta
cctgcgttattgaacgcgacacagcagttacccgagtacggtacgctggatgtggctaac
cctgagcttgactggcgttatggcttatataccggtagcgcaatctcacaaggtgcgaac
acgctctatcagtttttcttgcaaaaatatctcttcccaatggttgagaatcagagtgag
gttacattaagaaaaacgatgcactcaggtcagagcgaagaggtttatgccgcgctgaag
ctttatttgatgctgacgggtgaaggtaaatttgatcgtcaatatatgattgagcacgtg
acccaagattggcagaaaagtggaaaaattgagccttacgaagagaagagtattttcgtc
ggtcatttgaacacgctgtttaccctgaaagactggcggcagtatgggcaaccggcagac
agtgaactgattaagcaggctcgggcaatactggcggaaaaaacagtgaccgccagactt
tgggggcgtattcaatcccgcttattggccgatgcccctgccaatatgacgttacgtaaa
atggtgggtgagcacgcgacacaggtattcaccctgtcagatgatgaactactgcatgaa
gggatcccggggctttatacctacgcgggctaccatgaggtggttaaaaaaaaactgaca
cctttgctgatgttacttcaggaagaggataggtgggtgatggcgcaatcgctgtcatct
tctcttgaccccctgacgttaagacaagatgttctggtgatgtatttacaagggtatgcc
gcttattggaaacgctttctctccagtgttcgtctgatttctgtcgatgcggacagtgca
gagtatgctcaagggctgtctctggatattgctttgttaaggacgttagtttcagaaaat
tcaccgctactcaatttagccaggcaggcggtaaaagaaacgacactcgccgaaaaagaa
aaagccattactgatgagataaacatcagaacgcaagggcaattactcagccaggctaaa
aaattacaagaaacgatcgcgtttcgtgaaaataaactgattaaagagtgggttgataat
cgttttgaatccctgagagtctttgttaatggggaacagagtgctgatgtcacggggggc
aataatctttctgttcttcagggaacgcagatgagccgaataatcgggacattaaacgat
caatatacccgttttgttgtttataacagtgcctttgaatatggcgatattcctccgtta
tcccaggatggggaacgtattgcggtggaatcacaaacatggccggatccgtttagaaat
attattgcaccgttattaacgggctcatcccagaaatttgaaaataaagtgattactcac
acgtccaaagcgattgatatgggggtgggggaaatttgccggaatacgctgcaagggcgt
tacccatttgctgaaagtgagcaaattgttagtttgaatgattttgagcgtttcttcggt
actgacggtacggtggacagttatttcaagaaaaacttggagagtaaagtcgacacgtcc
tcaataccttggcgttataagggcagcgtaagtagtgaaggtttggcgttctttgaacag
gcggcaatgatcagaaacgtgctatttaataccaatgacggtaaaaaaatggcattagat
ttttccgtatcagtgcgttatttagcacccactatcacccaacttattatgaactttgat
ggtaatactgtgcgttattcccatggtcccgtaacgccagccttctttaaatggccgggt
ttacgtcaaggcaccattgtcagtttaacggcccaacgccagaaggcatccgcgatgccc
gatattctttttcgcggaccttgggcactcttgcagtgggctgatcaggccgatgaaatt
cgcgatgaagcgaatggcaaacagacgctgacttatctcatggggaaagatcgtgtcgag
cttgaagtctcaggtttaacgcatggtggtgaaaccattagcgatctgctgagagatttc
aaatgccccagtgtcaatgacatgaatggtatttggtaa

DBGET integrated database retrieval system