KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2580
Entry
YP_2580           CDS       T00165                                 

Gene name
ompA3
Definition
(GenBank) putative membrane protein
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
SSDB
Motif
Pfam: OmpA rve
Other DBs
NCBI-ProteinID: AAS62773
UniProt: Q0WCV9
Position
2859276..2860958
AA seq 560 aa
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHP
QVSTPIPQETAEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQK
RLTYIAEHHPSARVLTFFPFLPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQ
LSNERLSHNSDNAYWTGNINLANQQPIEITQALQSLSQRLELQDINHSRFATQRNVMAHN
LFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRHGAWSAWLEKKFGIIPSLAST
LSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHMLNTLWQEKNR
HEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHS
DNTGSSSMNMALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRR
VEVLILPTQDRTRMTEPKPL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtttaaggttaaattgaataaaacgctctctctattatggctggctgcggtcggcgcc
ctattggtgagtgtgaattttaagggaaatgcgttatggaataacgttattttcattact
ttcctggcgctgatggttcttgccatctggaaacattacgccctcaaacccaaacacccc
caagtgtcgactcccattccgcaggagacagcggaacctgtagaacaggagagtacggtt
attttaattctcggtccctatgctgagaaatggtttagtaacccagaatcgccagacagt
acacgtttttccagccatgcggtttggatattaatcacgaatcccgccgcgctgcaaaaa
cgcctcacatatattgctgaacatcatccatccgctcgggtattgacctttttccctttc
ttgccggatgtctatgagaatgcagcagtgatgatgtcaaaactcactgtgtggcagaac
actttttcaacgttatcactgcgatcccccctcccctgcgtatttgctatttacgcgcag
ttgagtaatgaacgccttagccataattctgataacgcatattggactggaaatattaat
cttgcgaaccagcagcctatcgagattacgcaagccctacagtcactgagccaacgactt
gagttacaagacatcaatcactcaagatttgcaactcagcgtaatgttatggcgcataat
ttatttacttggttgaatgaatcgggggtgacaaaccttctgcaatctattttctctcgc
acccccttacggctaacagatgtcattttgtcggataatggcaaagggttcatcaggcat
ggtgcctggtcagcctggctggaaaaaaagtttggcatcataccaagcttagcctcaacc
ttgtcactgccacctttcccagcggtgatcaatgaccagaagcccgcaatgaaaccacgg
gtgaaaacaccggtgataaaacctacccccgcatcccgcgggtggttatggagtgtatgc
ttcgccgcggtgctattagcctcacatatgctaaacaccctgtggcaagaaaaaaaccgg
catgagcaatttaaccaacagatggtgccgttggacaatatcagcgatttttctgctcag
tacctggcacgcagcatcacccagttaactgatgaaggtaaaatattaaccacatgcgtt
aatacatttgatgtcacacgttgggggctgtctcaatgcaagacgttattaagccaaatc
aaccgccggattgaatcctatgaaaatattcctgttttcagttttgcccaaaagctccct
ctgtttgactcaaacagtaccaagctgaaactgaactcacaaactaatgaaatgatgatg
gagttgttatcactggtcgaacggaataaagagaaaaaaatcttaattgttggccattct
gataacacaggcagttcctccatgaacatggcactttccgaacagcgtgcgctggccctt
cgcgattggttaattaaacgcagtgatatcactgtcgataattttattaccaagggaatg
ggggcttcagaaccggttgcgaccaatcacacggaagcgggtcgagaacaaaacagacgc
gtcgaagtactgatattacccacacaagatagaacaagaatgacggagcctaaaccttta
tga

DBGET integrated database retrieval system