KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2759
Entry
YP_2759           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_2759
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_2759
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_2759
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AAS62945
UniProt: Q8CLE0
Structure
PDB: 
3V4H

Position
3065530..3066099
AA seq 189 aa
MCLRIHMGSSYTRCFALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNW
DVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGD
PLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISAN
YDVKANMHS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtgcctccgtattcatatggggtcttcctacactcgatgttttgcattgagtgacatt
tataaaagtgctagagaggatattatggcgcaagatatgtttatcaaaattgatggtatt
gaaggtgagtctttggatgccaatcacaaaaacgaaatccaggtattagcttggaactgg
gatgttgctcaacactcgaatatgcacagcggttcaggtggcggttcaggtaaagcctct
gtttcagatttttgcttcgcacattatatcgataaagctagcccgaacttattgagctat
tgcttgttgggtaagcacattaaaaatgttcagttcgtactgcgtaaagctggtggcgat
ccgctggaatatctgacaattaaatttaccgatgtcatcattactcgtgttgatatggcg
ggttctttggaagatgaaacgcgtccacgtgaagaaattcgtttctcattcactaagatg
actcaggactatgttatgcagaatgctgaaggccataagtctggcgttatttctgctaac
tacgatgttaaagctaacatgcacagctaa

DBGET integrated database retrieval system