KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2760
Entry
YP_2760           CDS       T00165                                 

Definition
(GenBank) putative exported protein
  KO
K11906  type VI secretion system protein VasD
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_2760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_2760
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_2760
SSDB
Motif
Pfam: T6SS-SciN DUF4969
Other DBs
NCBI-ProteinID: AAS62946
UniProt: Q8CLD9
Position
3066313..3066912
AA seq 199 aa
MWIRLNVFLIRLSMILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLT
VEIATAADINPNDKGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRI
MLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQ
DPIMKVRVERLSISIKEMD
NT seq 600 nt   +upstreamnt  +downstreamnt
ttgtggataaggcttaacgtttttttaattaggctaagtatgattttaattaggctaagt
atgaataaaagtatccgaggggtttaccgggcgacacagtacttatttttggtactggta
acgttattgacgatagcctgtagttcaaaagtgcaacctgaaaaggctgaaaagcttacc
gtcgaaatcgcgacagcagcggatattaatccgaatgataaaggggtggcgaacccgcta
aggattgcactttatacactcaagagcaccgatgaatttcagtcgagtgatttcttcact
atcactgaagaaaatacgccatcgctaaaagaacaaatggataacgtgtttgaccggatt
atgttgccaagcgagaccaaaaaaatagagctgacacttgatgctggcgttactgctatc
ggcatcgtggctgcttatcgtgaaattgaacaggcggagtggaaagcggttatttatccg
ttgcccaaaaaacgcgtggatccttggtataaaaaaatgtggccagggcaagaccaacaa
gatccgatcatgaaggtacgcgttgagcgtctgtcaatatcaattaaagaaatggattaa

DBGET integrated database retrieval system