KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2761Help
Entry
YP_2761           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_2761
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AAS62947
UniProt: A0A454XIZ7
Position
3066916..3068265
Genome map
AA seq 449 aa AA seqDB search
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLV
LRSGKGVLPDGTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSS
LARFYAYEAALNDTNAIRQGPKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSV
LLHTEDYIPPVTGYAASSLLSEWLTHLNGLVKMRAEMLANRLSNSDGKASASAEIVDYLL
LQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFIRTKTRRPRPAPGYDHAKLYA
SIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLVLAVHAQLPMD
VLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgagaactaacaaagtcgtttggagtgaggggctttttcttcgcccacaactttttcaa
cagcaagagcgctatcttgaatattacgcccataagcgagctgcaacgataaccccattc
ttttggggatttgcgcaatatgaaattgatagagaagcactctcgtatggcaaattagta
ttgcgatctgggaagggcgtgttacccgacggtacaccatttgatattcccggccatgct
gaattgcctgaaccgctcactatcaccccagaacatctgggtaagttgatctatctggcg
gtaccactgcgcctggataacagtgatgaaaccatttttgatgagcacgatatgagctca
ttggcacgtttttacgcctatgaagctgcgctcaacgataccaatgccattcggcaaggg
ccgaagccggtacaactgtcaagattacgtctcagattagtctcagaaggtgagatgaca
gaatcatggattgggctgccattaaccaaagtcagagcgattcagcctgatgggagtgtc
ttgctacacaccgaagactatattcctccggtgacgggttatgccgcaagttcattgctg
tctgaatggctaacccatcttaatggtttggttaaaatgcgcgcagagatgttggccaat
cgcttgtcaaacagtgatgggaaagcgagcgccagcgcagaaattgtcgattatttgtta
ctgcaaatttttaataaatatgagccgattctcgatcatttaaggcatattcctgaatta
ccgcctattacgctttatcaggaattggctaagttctcgggggaattatctacctttatc
cggaccaaaacccgccgaccccgcccggcacctggctatgatcatgcgaagctctatgcg
tctattcgtccgttggttgacgaagttcatgaactactgaaccagatcttggtgcgtgct
gggcagatgataccgctggagacgaaaggcaatggcgtttggtctgcctccgtactgcct
aatgaattacgctcgttttcaaatctggtccttgccgttcatgcgcaattaccgatggat
gtgctacagcatcaattttcagtacaaacaaaaatcagcgcacctcagcaattgcatgaa
ctggtgcgatcgcatttgccagggttggaactacagcgtttgccggtaccgcccagacaa
attccgtatagcgcagggtacgtttattttgaattgataaaaaatggccccttctgggac
aaagtttccaatgctggtgccattgccctgcatgtggcgggtgatttccctgccttgaaa
atggagctctgggggattagagattcatga

DBGET integrated database retrieval system