KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2813Help
Entry
YP_2813           CDS       T00165                                 

Gene name
rluA2
Definition
(GenBank) Pseudouridylate synthases, 23S RNA-specific
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypm03016]
    YP_2813 (rluA2)
Enzymes [BR:ypm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     YP_2813 (rluA2)
Transfer RNA biogenesis [BR:ypm03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    YP_2813 (rluA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AAS62997
UniProt: Q8ZH72
Position
complement(3123765..3124538)
Genome map
AA seq 257 aa AA seqDB search
MLEIIYQDEHIVAVNKPAGWLVHRSWLDRNETVFVMQTVRDQIGQHVYTVHRLDRPTSGV
LLMALSSDVARMLSLQFEQHQIQKTYHAVVRGYVLEGGTVDYAMAEELDKIADKFAKSDK
APQPSVSHYEALAQVEVPLAIGRYETARYSLVALKPETGRKHQLRRHMAHIRHPIIGDST
HGDLRQNRGVAQHFGCSRLMLHASHLHLNHPVTGEALTLTARWDEPWQGLMSQFGWSGIA
PHLERVEFPLTASQDNE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattatctatcaagatgaacacattgttgcggtgaataagcctgccggttgg
ttagtgcatcgtagttggttggaccgcaatgaaacggtatttgttatgcaaacggtacgt
gatcagattggtcagcatgtgtataccgttcatcgccttgatcgcccgacatcaggcgta
ttgctcatggcattgtccagtgatgtggctcgtatgttgtcgttacaatttgagcaacac
cagattcagaaaacgtatcatgcggtggtgcgcggatatgtattggaaggtggcaccgtt
gattacgcgatggccgaagagctggataaaatagcggataagtttgctaagtctgataag
gctccacagccttctgtcagccattatgaagcattagcgcaagtggaagttcctttggcg
attggccgctatgaaactgctcgctatagcttggtggcattgaaaccggaaacgggtcgt
aagcaccagttgcgtcggcatatggctcatatccgtcaccccattattggtgacagtaca
catggtgatttacgtcagaacagaggtgtcgctcagcattttggttgttcacggttgatg
ctgcatgccagccatttacacctcaatcaccctgtgaccggtgaagcgctgacgcttacc
gctcgttgggatgaaccctggcaagggttgatgtcacaatttggctggtcgggtattgcc
cctcatcttgaaagggttgagtttccgctgactgccagtcaggataatgaataa

DBGET integrated database retrieval system