KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3492Help
Entry
YP_3492           CDS       T00165                                 

Gene name
glsA2
Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00220  Arginine biosynthesis
ypm00250  Alanine, aspartate and glutamate metabolism
ypm00471  D-Glutamine and D-glutamate metabolism
ypm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YP_3492 (glsA2)
   00220 Arginine biosynthesis
    YP_3492 (glsA2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YP_3492 (glsA2)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YP_3492 (glsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AAS63647
UniProt: Q8ZHF1
Position
3970186..3971112
Genome map
AA seq 308 aa AA seqDB search
MVTTLDNALLNDILQQVRPLIGQGKVADYIPALAEVPANKLGIAVCTLDGQIFQAGDADE
RFSIQSISKVLSLTLALSRYSEQDIWQRVGKEPSGQPFNSLVQLELEKGKPRNPFINLGA
LVVCDMLQSRLSAPKQRLLEVVRQLVKDDSISYDPRVARSEFEHSDRNAAIAYLMKSFGN
FDNDVLTVLQTYFHYCAMRMSCVELARCFVYLANQGRSISGSESLITPMQARQINALMIT
SGMYDGAGEFAFRVGMPGKSGVGGGIIAIVPDEFCIAVWSPELDHAGNSLAGTAALERLA
QQMGRSIF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacaacgttagataatgccttactaaacgatatattacagcaggtccgcccgttg
attggtcagggtaaagtcgctgattatattcccgcactggcggaggttccggccaataag
ctgggaattgccgtttgtacactggatggtcagatatttcaggcaggggatgccgatgaa
cgcttctctatccaatcgatttctaaagtattaagtctgacgctggccttatcccgttac
agtgagcaagatatttggcagcgggtgggtaaagagccttctggccagccattcaactca
ttggttcagttggagttagaaaagggaaaaccccgtaacccatttattaatctaggggcg
ctggtggtctgcgatatgttgcaaagccgcctgagtgccccaaaacaacgtctgttggaa
gttgtacgccagttagtgaaggatgacagcatcagttacgatcctcgtgtggcgcgttcc
gaatttgagcattcagatcgcaatgcggctattgcttatctaatgaagtcttttggtaat
ttcgataacgacgtattgacggtattgcagacctatttccactactgtgcgatgcgtatg
agctgtgtcgagttggcccgttgctttgtttatctggcgaatcaggggcgcagcatcagt
ggctccgagtctttaattacccccatgcaggcgcggcaaattaatgctctgatgatcact
agcggcatgtatgatggtgcaggggagtttgccttccgagtcgggatgccgggtaaatcg
ggggttggtggtggtattattgccattgttccggatgagttctgtattgccgtttggtca
cctgaattggatcatgcagggaactcattggcgggtaccgctgccttagagagattggcg
caacaaatgggtcgttctatcttttaa

DBGET integrated database retrieval system