KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3664
Entry
YP_3664           CDS       T00165                                 

Gene name
icmF3
Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3664 (icmF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3664 (icmF3)
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3664 (icmF3)
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C AAA_16 AAA Rad17 AAA_19
Other DBs
NCBI-ProteinID: AAS63812
UniProt: Q8CKD9
Position
complement(4169452..4172946)
AA seq 1164 aa
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFS
WIFRYARAPLPKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDA
KPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAG
EWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSSVTERKSLADTLR
LRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNFV
ADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPI
GYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQ
VNDNLVAAYEQLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYV
TNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLF
SYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDAPLPARIEDLSLA
DAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDGK
ASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPS
SPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFS
RLQIDMARQPEPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNR
LASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFEN
SAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGSNQPVKVDWPGPK
GGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKIE
LSSTMKDYPLWSKALAQFSCPKNL
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgatacgcagaatgttgattttaatcattgccctagtgctttgttatattgtgtggtgg
atagggccgctgatcgccattggcccctatttccctctggggggggtatgggttcgtaag
atcattattgctctgattttattttgggcactgtggccatttgttgcaattttcttcagt
tggatttttcgttatgcccgtgcgccacttcccaagcgcaagaaaaaaacggttcagctt
gatcgcgtttctgcacgttttcatgatgcgatgctcaccctgcaacatgcggatctttca
agccagaaaacacgctggcagcgctggcgtcaacggcgtaagcgccagtatatcgatgct
aaaccgtggtttctggtcatggggccacccggatgcggtaaaacgtcgatagtttatgag
agtagcgagaagttcctactctcagaacagtatggtttagcgcagaccacggatattgga
ccgacgcaggactgtaattggtggctgacggatcgtgctgtttacatcgatacggcaggg
gaatggatcctgctgcatggtcagagcgaagaagcgggcacggctcggcaaaaattgttc
tctatgatccgcaaatatcgccgttatccgggggttgatgggattgttctttgccttgac
gtcagcgtgcttttgaactcttcggtgacggaacgtaagtcactggctgatacgttgcgc
ctgcggatcctggaagttgcctcgacatttcaggccgatattgcggtgtacttgttcctc
aacaatatcgataagttacctggcggcgaaaccttcctctcgttaatgaacgacgaactt
ctggccggagggcttgggattagcatgacccataatgaaaaggggcagaacaatttcgtt
gccgatgaagaacgttaccgtgaactcctgacacgtgttagccgttatgtgttggaaata
ctgcacgattcgcccaacatggagatgcgccaccaattgctgctgtttacagaaagcctg
ggagcgctacaaaaacccctgtttggcttattcgaacaaatatttccggcgacaccgatt
ggctataccggttgtttgcggcagttctggtttggcagtacccaaaatctgacctcatgg
gaggcgctgtattatccgtcatcgaccagcacctttgaaagccggcctgctgggcagatg
tatttccctgcactgagtcaagcgatcaccgaaaggggggtattacacgccactggcccc
atgcctttgcgaaatcgcctgttaaacatcggtaaatatgtgttcgtggtccttgtgctc
tgcatcttattgttgatgctgagcgcccgctatttttgggaatatgactatattggctat
gcgacagctcggtttgaggaaacccgtcggattgtgcgtgacatcccaatcacgaatcag
gtcaacgataatctggtcgcagcttacgaacagttggggtatatcaacacccattatctg
gaaagttcaccgccactgctgacaccgtacttcgagcaccgtttactgaatcaggcgatg
ttgcaaacctaccatcgtcacctgaataaagtgttctggcctgcggtacaaaactacgtc
accaacgagctgaaaaaggacactcaatctcctgacggtgacaactatgacacgctgaaa
gtttacctgatgctcggacaacctgatcaccgctctcaggaggcattggtgcaatggttt
atgtcgcgctgggaaagttttgcgcctcagggatatgggcaaaacgaccgcaaactcttc
agttatcatttgagtgaactgttttctgacaccgcctcagctgccccgaaagttaagctg
aatgatgagctgatccgtgaatcacgcattaaagcgatgaaaacaccgatacacatccgg
gtgattaatcgtattcatgacgccccactgcccgcgaggattgaggatcttagtctggcg
gatgccgccggtcctagcgtaacactgatgctgagacgtaaaagccccagtacagtaacg
gatttggcgatcccggctttctacactcgggccagctaccacgatgtggttaacccacaa
cttcaggaagcatcggaagcgatgattaacgaggaagcgtgggtgttgagtgacggtaaa
gcttcggttagtcaggttagtttactggctgcggcgcaaaaactgtccgatgaagcgcgc
aagtattatctgatggagtatgccaaccaatgggatgcattcttcaatgatatcagggtg
cgcccaatcaacggacttgatgatgcggcgctgctggcaaggcaactctcagacccgtca
tccccgttggctaatctggtgcgtttctccacacgggaaataaccctgaccactgacaac
aatggtaaaggggcgatgtcgtcaggctggttcaatattcaacgtaataagctcacgact
gcccgccgtaacatcattgacgaaatgtcgggtgagcgttctcgttttcgtctaacgcca
gagaaagcggtggaggatcgctttgaactattaagacgtctgggatatgccctgcaaagt
gcgtctaccagcaattctgatccgttgggccgaaccttcgagcagatttataaccagttg
ataacactctcgacttcccttcgggctgggcagattttgccgcaaaataacgatttcagt
cgcttgcaaatcgatatggcccgtcagccagagccggtgcgcagcattatgatggatctg
ctggccgtcggacaaacgcaaagtctgcaacaaagtaaggccaacctcagcaagggcgtc
tcttcaattgcttctgatttatgtagcaacgccgtcagtggccgttatccctttaatcgg
ttggctagcgaagagataggtattggcgatttcaaccgtatgtttggtcgttctggggcg
atgcaaagcttctttgatcagaatctcgcaccgtatgtcgataccaacggcaaccgctgg
aaggtaaaacctgacagtaacggtgtggtgacccctaaaactctgcgttcgtttgaaaac
tcagcacaaatccgcgacaccttctttgatgcctccggcaagatggcgatgtcgatgatc
attcgccctatctcactgactccatcaattttggaagcggttcttgatgtcgatggccag
attattaactacagccatggttctaaccaaccggtaaaagttgattggccaggaccgaaa
ggtggggtgtatatccgcctgacgttcaaaactcaggatggaaatgtggaaaccgttagc
ttcaatggtccgtgggctattttccgcatgtatgacgttagtaaccctaggccactcggg
gtcaatagccgtgaactcatgatggtgatggataacgtgagtggcgtcttcaaaattgag
ttgagttccaccatgaaagattatccgctgtggtcaaaagcattggcacagttctcatgt
cctaagaatctctaa

DBGET integrated database retrieval system