KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3665Help
Entry
YP_3665           CDS       T00165                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YP_3665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypm02044]
    YP_3665
Secretion system [BR:ypm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YP_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: AAS63813
UniProt: Q8CKD8
Position
complement(4172955..4174592)
Genome map
AA seq 545 aa AA seqDB search
MGLATRKARMNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSS
TSQAENYKEGLADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGS
NNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRSWPTRNAAEVRP
PIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAW
GGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLY
GQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNILT
WVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFIN
KKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINE
THQREISAIGRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQG
TNTQQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggggcttgcgacaaggaaggctcggatgaacgaatttgaacgccagatccgtgcagcc
atttccgcagcacgcaatggcgcaaaacatgcggaacagtcactgactacaccaatgtgg
caagccaaaagcaccgtagcctcattgggtgggattgtccctagaagtggctcttcgtca
acgtcacaggcggagaactataaggaaggtctcgcggaccaggctgcctcgggcaacaac
atggcgcgcacgagtgcgccaccggtcactttgtatcagcaacagccaaatgcgaatgac
agctatccaaacgggaataacaacaatccaaacggggataacaacaatccaaacgggagt
aacaacaatatagcgagagtacagcgtatgccgcatggcatttccaggggcttatatgag
cgccctgggatgttattgggtgcctgggataacgcctatattgctgcggctatgcctttg
ctgctgctggtggaaaatattcgtagctggccgacgcgtaacgccgcagaggtcaggcca
ccgattgtgcgggaattacaatatttccagcaacatttgcagaaaaagaactacccgcaa
gaagacattaaccacctgtcttacctgctatgtacctatatcgatggcatttttaacggg
ctgcaaaccccagactcctacaaccaaagtctgttagtggagtttcaccgtgatgcctgg
gggggtgaggactgcttcgaacatctgcgggtctatatgaactcgccgaaacagtaccgg
gaagttctggaattctatgatctgattatgtgccttggttttgacggtaaataccagatg
atagagcatggtgcggttctgctgatggatttacgcagccgtctccacacgcaactctac
ggtcaggacgccacacaatctttggctatcgcgcaagcggtcaaaggttctccgcgtcgc
caatatatcaaggcgctgaaaatcttcacctatggtttcgcactgtgcctttgtgcttac
ggcgtcacggcgtggtatctgcaccagcaatcccaacagatccgcagcaacattctgacg
tgggtactgcctgaaccgcggaaaatcaacatcatggagaccttgccgaatccgctatcc
aacatcctgaatgaagggtggctggaggtcaggaaagatccgcgtggatggctattaatc
ttcacctccgacggcgcgttccgcacgggtgaagcgaccctctcggaagagtttatcaac
aagaagaatatcgaacgtcttgggctggcattagccccatggccgggagatatcgaggtt
attggtcatacggataacaaaccgttccgtagcacttccggtaacaacaacctcaaactt
tccgcggccagagcatcggtggtggcagataaactgcgggaatccactcaaatcaacgaa
acccatcagcgagaaataagtgccatcggacggggggagagcgatcctttagctgacaat
gcaacggaagaagggcgcaagcgtaaccggcgtgtggatatcctatggaaaattggtcag
cgcgatgccgataaggccatgaagcaattcctggagaacccaacaccagaagttcaagga
acgaatacccaacaatag

DBGET integrated database retrieval system